KIF15

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF15
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIF15, HKLP2, KNSL7, NY-BR-62, kinesin family member 15, KLP2
Зовнішні ІД OMIM: 617569 MGI: 1098258 HomoloGene: 23210 GeneCards: KIF15
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_020242
NM_010620
RefSeq (білок)
NP_064627
NP_034750
Локус (UCSC) Хр. 3: 44.76 – 44.87 Mb Хр. 9: 122.95 – 123.02 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF15 (англ. Kinesin family member 15) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 388 амінокислот, а молекулярна маса — 160 160[4].

Послідовність амінокислот
1020304050
MAPGCKTELRSVTNGQSNQPSNEGDAIKVFVRIRPPAERSGSADGEQNLC
LSVLSSTSLRLHSNPEPKTFTFDHVADVDTTQESVFATVAKSIVESCMSG
YNGTIFAYGQTGSGKTFTMMGPSESDNFSHNLRGVIPRSFEYLFSLIDRE
KEKAGAGKSFLCKCSFIEIYNEQIYDLLDSASAGLYLREHIKKGVFVVGA
VEQVVTSAAEAYQVLSGGWRNRRVASTSMNRESSRSHAVFTITIESMEKS
NEIVNIRTSLLNLVDLAGSERQKDTHAEGMRLKEAGNINRSLSCLGQVIT
ALVDVGNGKQRHVCYRDSKLTFLLRDSLGGNAKTAIIANVHPGSRCFGET
LSTLNFAQRAKLIKNKAVVNEDTQGNVSQLQAEVKRLKEQLAELASGQTP
PESFLTRDKKKTNYMEYFQEAMLFFKKSEQEKKSLIEKVTQLEDLTLKKE
KFIQSNKMIVKFREDQIIRLEKLHKESRGGFLPEEQDRLLSELRNEIQTL
REQIEHHPRVAKYAMENHSLREENRRLRLLEPVKRAQEMDAQTIAKLEKA
FSEISGMEKSDKNQQGFSPKAQKEPCLFANTEKLKAQLLQIQTELNNSKQ
EYEEFKELTRKRQLELESELQSLQKANLNLENLLEATKACKRQEVSQLNK
IHAETLKIITTPTKAYQLHSRPVPKLSPEMGSFGSLYTQNSSILDNDILN
EPVPPEMNEQAFEAISEELRTVQEQMSALQAKLDEEEHKNLKLQQHVDKL
EHHSTQMQELFSSERIDWTKQQEELLSQLNVLEKQLQETQTKNDFLKSEV
HDLRVVLHSADKELSSVKLEYSSFKTNQEKEFNKLSERHMHVQLQLDNLR
LENEKLLESKACLQDSYDNLQEIMKFEIDQLSRNLQNFKKENETLKSDLN
NLMELLEAEKERNNKLSLQFEEDKENSSKEILKVLEAVRQEKQKETAKCE
QQMAKVQKLEESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCE
KTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILDLKETLRLR
ILSEDIERDMLCEDLAHATEQLNMLTEASKKHSGLLQSAQEELTKKEALI
QELQHKLNQKKEEVEQKKNEYNFKMRQLEHVMDSAAEDPQSPKTPPHFQT
HLAKLLETQEQEIEDGRASKTSLEHLVTKLNEDREVKNAEILRMKEQLRE
MENLRLESQQLIEKNWLLQGQLDDIKRQKENSDQNHPDNQQLKNEQEESI
KERLAKSKIVEEMLKMKADLEEVQSALYNKEMECLRMTDEVERTQTLESK
AFQEKEQLRSKLEEMYEERERTSQEMEMLRKQVECLAEENGKLVGHQNLH
QKIQYVVRLKKENVRLAEETEKLRAENVFLKEKKRSES

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Sueishi M., Takagi M., Yoneda Y. (2000). The forkhead-associated domain of Ki-67 antigen interacts with the novel kinesin-like protein Hklp2.. J. Biol. Chem. 275: 28888 — 28892.  PubMed DOI:10.1074/jbc.M003879200
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:17273 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q9NS87 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]