KIF17

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF17
Ідентифікатори
Символи KIF17, Kif17, 5930435E01Rik, AW492270, Kif17b, mKIAA1405, KIF3X, KLP-2, OSM-3, kinesin family member 17
Зовнішні ІД OMIM: 605037 HomoloGene: 5883 GeneCards: KIF17
Шаблон експресії
PBB GE KIF17 222144 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001122819
NM_001287212
NM_020816
RefSeq (білок)
NP_001116291
NP_001274141
NP_065867
Локус (UCSC) Хр. 1: 20.66 – 20.72 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF17 (англ. Kinesin family member 17) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 029 амінокислот, а молекулярна маса — 115 068[4].

Послідовність амінокислот
1020304050
MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAADEPPK
QFTFDGAYHVDHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFT
MQGLPDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDL
LGADTKQKLELKEHPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGY
TLMNKDSSRSHSIFTISIEMSAVDERGKDHLRAGKLNLVDLAGSERQSKT
GATGERLKEATKINLSLSALGNVISALVDGRCKHVPYRDSKLTRLLQDSL
GGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALL
REYQEEIKKLKAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQH
DVEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLS
TLEENLRKETEAVLQVGVLYKAEVMSRAEFASSAEYPPAFQYETVVKPKV
FSTTDTLPSDDVSKTQVSSRFAELPKVEPSKSEISLGSSESSSLEETSVS
EAFPGPEEPSNVEVSMPTEESRSRYFLDECLGQEAAGHLLGEQNYLPQEE
PQEVPLQGLLGLQDPFAEVEAKLARLSSTVARTDAPQADVPKVPVQVPAP
TDLLEPSDARPEAEAADDFPPRPEVDLASEVALEVVRTAEPGVWLEAQAP
VALVAQPEPLPATAGVKRESVGMEVAVLTDDPLPVVDQQQVLARLQLLEQ
QVVGGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGDWVLLNV
YDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQ
ERDSMLLQQLLEQVQPLIRRDCNYSNLEKILRESCWDEDNGFWKIPHPVI
TKTSLPVAVSTGPQNKPARKTSAADNGEPNMEDDRYRLMLSRSNSENIAS
NYFRSKRASQILSTDARKSLTHHNSPPGLSCPLSNNSAIPPTQAPEMPQP
RPFRLESLDIPFTKAKRKKSKSNFGSEPL

Кодований геном білок за функцією належить до білкових моторів. Задіяний у таких біологічних процесах як транспорт, транспорт білків, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, клітинних відростках.

Література[ред. | ред. код]

  • Chennathukuzhi V., Morales C.R., El-Alfy M., Hecht N.B. (2003). The kinesin KIF17b and RNA-binding protein TB-RBP transport specific cAMP-responsive element modulator-regulated mRNAs in male germ cells.. Proc. Natl. Acad. Sci. U.S.A. 100: 15566 — 15571.  PubMed DOI:10.1073/pnas.2536695100
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 65 — 73.  PubMed DOI:10.1093/dnares/7.1.65

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:19167 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q9P2E2 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]