KIF18A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF18A
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIF18A, MS-PPP1R99, kinesin family member 18A
Зовнішні ІД OMIM: 611271 MGI: 2446977 HomoloGene: 41820 GeneCards: KIF18A
Шаблон експресії
PBB GE KIF18A 221258 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_031217
NM_139303
RefSeq (білок)
NP_112494
NP_647464
Локус (UCSC) Хр. 11: 28.02 – 28.11 Mb Хр. 2: 109.28 – 109.34 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF18A (англ. Kinesin family member 18A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 898 амінокислот, а молекулярна маса — 102 281[4].

Послідовність амінокислот
1020304050
MSVTEEDLCHHMKVVVRVRPENTKEKAAGFHKVVHVVDKHILVFDPKQEE
VSFFHGKKTTNQNVIKKQNKDLKFVFDAVFDETSTQSEVFEHTTKPILRS
FLNGYNCTVLAYGATGAGKTHTMLGSADEPGVMYLTMLHLYKCMDEIKEE
KICSTAVSYLEVYNEQIRDLLVNSGPLAVREDTQKGVVVHGLTLHQPKSS
EEILHLLDNGNKNRTQHPTDMNATSSRSHAVFQIYLRQQDKTASINQNVR
IAKMSLIDLAGSERASTSGAKGTRFVEGTNINRSLLALGNVINALADSKR
KNQHIPYRNSKLTRLLKDSLGGNCQTIMIAAVSPSSVFYDDTYNTLKYAN
RAKDIKSSLKSNVLNVNNHITQYVKICNEQKAEILLLKEKLKAYEEQKAF
TNENDQAKLMISNPQEKEIERFQEILNCLFQNREEIRQEYLKLEMLLKEN
ELKSFYQQQCHKQIEMMCSEDKVEKATGKRDHRLAMLKTRRSYLEKRREE
ELKQFDENTNWLHRVEKEMGLLSQNGHIPKELKKDLHCHHLHLQNKDLKA
QIRHMMDLACLQEQQHRQTEAVLNALLPTLRKQYCTLKEAGLSNAAFESD
FKEIEHLVERKKVVVWADQTAEQPKQNDLPGISVLMTFPQLGPVQPIPCC
SSSGGTNLVKIPTEKRTRRKLMPSPLKGQHTLKSPPSQSVQLNDSLSKEL
QPIVYTPEDCRKAFQNPSTVTLMKPSSFTTSFQAISSNINSDNCLKMLCE
VAIPHNRRKECGQEDLDSTFTICEDIKSSKCKLPEQESLPNDNKDILQRL
DPSSFSTKHSMPVPSMVPSYMAMTTAAKRKRKLTSSTSNSSLTADVNSGF
AKRVRQDNSSEKHLQENKPTMEHKRNICKINPSMVRKFGRNISKGNLR

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, транспорт білків. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, ядрі, клітинних відростках.

Література[ред. | ред. код]

  • Luboshits G., Benayahu D. (2005). MS-KIF18A, new kinesin; structure and cellular expression.. Gene 351: 19 — 28.  PubMed DOI:10.1016/j.gene.2005.02.009
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Luboshits G., Benayahu D. (2007). MS-KIF18A, a kinesin, is associated with estrogen receptor.. J. Cell. Biochem. 100: 693 — 702.  PubMed DOI:10.1002/jcb.21000
  • Stumpff J., von Dassow G., Wagenbach M., Asbury C., Wordeman L. (2008). The kinesin-8 motor Kif18A suppresses kinetochore movements to control mitotic chromosome alignment.. Dev. Cell 14: 252 — 262.  PubMed DOI:10.1016/j.devcel.2007.11.014
  • Zusev M., Benayahu D. (2008). New insights on cellular distribution, microtubule interactions and post-translational modifications of MS-KIF18A.. J. Cell. Physiol. 217: 618 — 625.  PubMed DOI:10.1002/jcp.21525
  • Gardner M.K., Odde D.J., Bloom K. (2008). Kinesin-8 molecular motors: putting the brakes on chromosome oscillations.. Trends Cell Biol. 18: 307 — 310.  PubMed DOI:10.1016/j.tcb.2008.05.003

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:29441 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q8NI77 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]