KIF25

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF25
Ідентифікатори
Символи KIF25, KNSL3, kinesin family member 25
Зовнішні ІД OMIM: 603815 HomoloGene: 49939 GeneCards: KIF25
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005355
NM_030615
XM_681410
XM_021468639
RefSeq (білок)
NP_005346
NP_085118
XP_686502
XP_021324314
Локус (UCSC) Хр. 6: 168 – 168.05 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF25 (англ. Kinesin family member 25) – білок, який кодується однойменним геном, розташованим у людей на 6-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 384 амінокислот, а молекулярна маса — 40 686[4].

Послідовність амінокислот
1020304050
MTWTSGQLQREKQARPGSGAVLAFPDDKDLRVYGPAESQSAVFGDVCPLL
TSLLDGYNVCVMAYGQTGSGKSYTMLGRHSDDGPVLPLDPQSDLGIIPRV
AEELFRLILENTSRSPKVEVSIVEVYNNDIFDLLAKDSIAAVSGVKREVV
TAKDGRTEVALLASEAVGSASKLMELVHGGLQLRAKHPTLVHADSSRSHL
IITVTLTTASCSDSTADQACSATLPREQTEAGRAGRSRRASQGALAPQLV
PGNPAGHAEQVQARLQLVDSAGSECVGVSGVTGLALREMACISRSLAALA
GVLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQT
LQGLGFGIRARQVQRGPARKKPPSSQTEGKRRPD

Кодований геном білок за функцією належить до білкових моторів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Okamoto S., Matsushima M., Nakamura Y. (1998). Identification, genomic organization, and alternative splicing of KNSL3, a novel human gene encoding a kinesin-like protein.. Cytogenet. Cell Genet. 83: 25 — 29.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6390 (англ.). Процитовано 19 вересня 2017. 
  4. UniProt, Q9UIL4 (англ.). Процитовано 19 вересня 2017. 

Див. також[ред. | ред. код]