KIF2A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF2A
Protein KIF2A PDB 2gry.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIF2A, CDCBM3, HK2, KIF2, kinesin heavy chain member 2A, kinesin family member 2A
Зовнішні ІД OMIM: 602591 MGI: 108390 HomoloGene: 3320 GeneCards: KIF2A
Пов'язані генетичні захворювання
complex cortical dysplasia with other brain malformations 3[1]
Шаблон експресії
PBB GE KIF2A 213598 at fs.png

PBB GE KIF2A 203087 s at fs.png

PBB GE KIF2A 203086 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004520
NM_001098511
NM_001243952
NM_001243953
NM_001145779
NM_008442
RefSeq (білок)
NP_001091981
NP_001230881
NP_001230882
NP_004511
NP_001139251
NP_032468
Локус (UCSC) Хр. 5: 62.31 – 62.54 Mb Хр. 13: 106.96 – 107.02 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF2A (англ. Kinesin family member 2A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 706 амінокислот, а молекулярна маса — 79 955[5].

Послідовність амінокислот
1020304050
MATANFGKIQIGIYVEIKRSDGRIHQAMVTSLNEDNESVTVEWIENGDTK
GKEIDLESIFSLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVAS
IKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDISPVQAAKKEFG
PPSRRKSNCVKEVEKLQEKREKRRLQQQELREKRAQDVDATNPNYEIMCM
IRDFRGSLDYRPLTTADPIDEHRICVCVRKRPLNKKETQMKDLDVITIPS
KDVVMVHEPKQKVDLTRYLENQTFRFDYAFDDSAPNEMVYRFTARPLVET
IFERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLML
KKPNYKKLELQVYATFFEIYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQ
EREVKCVEDVLKLIDIGNSCRTSGQTSANAHSSRSHAVFQIILRRKGKLH
GKFSLIDLAGNERGADTSSADRQTRLEGAEINKSLLALKECIRALGRNKP
HTPFRASKLTQVLRDSFIGENSRTCMIATISPGMASCENTLNTLRYANRV
KELTVDPTAAGDVRPIMHHPPNQIDDLETQWGVGSSPQRDDLKLLCEQNE
EEVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESIRWLEDEKALLEMTE
EVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINP
KRPRAL

Кодований геном білок за функціями належить до білкових моторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як клітинний цикл, поділ клітини, мітоз, диференціація, нейрогенез, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Debernardi S., Fontanella E., de Gregorio L., Pierotti M.A., Delia D. (1997). Identification of a novel human kinesin-related gene (HK2) by the cDNA differential display technique.. Genomics 42: 67 — 73.  PubMed DOI:10.1006/geno.1997.4720
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Jang C.Y., Coppinger J.A., Seki A., Yates J.R. III, Fang G. (2009). Plk1 and Aurora A regulate the depolymerase activity and the cellular localization of Kif2a.. J. Cell Sci. 122: 1334 — 1341.  PubMed DOI:10.1242/jcs.044321

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]