KIF2C

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF2C
Protein KIF2C PDB 1v8j.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIF2C, CT139, KNSL6, MCAK, kinesin family member 2C
Зовнішні ІД OMIM: 604538 MGI: 1921054 HomoloGene: 21355 GeneCards: KIF2C
Шаблон експресії
PBB GE KIF2C 211519 s at fs.png

PBB GE KIF2C 209408 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001297655
NM_001297656
NM_001297657
NM_006845
NM_001290662
NM_134471
RefSeq (білок)
NP_001284584
NP_001284585
NP_001284586
NP_006836
NP_001277591
NP_608301
Локус (UCSC) Хр. 1: 44.74 – 44.77 Mb Хр. 4: 117.16 – 117.18 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF2C (англ. Kinesin family member 2C) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 725 амінокислот, а молекулярна маса — 81 313[4].

Послідовність амінокислот
1020304050
MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGA
TKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI
PAPKESLRSRSTRMSTVSELRITAQENDMEVELPAAANSRKQFSVPPAPT
RPSCPAVAEIPLRMVSEEMEEQVHSIRGSSSANPVNSVRRKSCLVKEVEK
MKNKREEKKAQNSEMRMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTM
TDPIEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHEPKLKVDL
TKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQT
GSGKTHTMGGDLSGKAQNASKGIYAMASRDVFLLKNQPCYRKLGLEVYVT
FFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVIKMID
MGSACRTSGQTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNERGA
DTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRD
SFIGENSRTCMIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQLI
QMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAME
ELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALRDV
IKALRLAMQLEEQASRQISSKKRPQ

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як клітинний цикл, поділ клітини, мітоз, розходження хромосом, поліморфізм, ацетиляція. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, ядрі, хромосомах, центромерах, кінетохорі.

Література[ред. | ред. код]

  • Kim I.-G., Jun D.Y., Sohn U., Kim Y.H. (1997). Cloning and expression of human mitotic centromere-associated kinesin gene.. Biochim. Biophys. Acta 1359: 181 — 186.  PubMed DOI:10.1016/S0167-4889(97)00103-1
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bakhoum S.F., Thompson S.L., Manning A.L., Compton D.A. (2009). Genome stability is ensured by temporal control of kinetochore-microtubule dynamics.. Nat. Cell Biol. 11: 27 — 35.  PubMed DOI:10.1038/ncb1809
  • Shrestha R.L., Draviam V.M. (2013). Lateral to end-on conversion of chromosome-microtubule attachment requires kinesins CENP-E and MCAK.. Curr. Biol. 23: 1514 — 1526.  PubMed DOI:10.1016/j.cub.2013.06.040
  • Shrestha R.L., Draviam V.M. (2013). Curr. Biol. 23: 2440 — 2441. 

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6393 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q99661 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]