KIF3B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF3B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIF3B, FLA8, HH0048, KLP-11, kinesin family member 3B
Зовнішні ІД OMIM: 603754 MGI: 107688 HomoloGene: 55849 GeneCards: KIF3B
Шаблон експресії
PBB GE KIF3B 203943 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004798
NM_008444
RefSeq (білок)
NP_004789
NP_032470
Локус (UCSC) Хр. 20: 32.28 – 32.34 Mb Хр. 2: 153.29 – 153.33 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF3B (англ. Kinesin family member 3B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 747 амінокислот, а молекулярна маса — 85 125[4].

Послідовність амінокислот
1020304050
MSKLKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTA
HEMPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGT
GKTYTMEGIRGDPEKRGVIPNSFDHIFTHISRSQNQQYLVRASYLEIYQE
EIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQN
RSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSE
RQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRL
LQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDP
KDALLREFQEEIARLKAQLEKRSIGRRKRREKRREGGGSGGGGEEEEEEG
EEGEEEGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKMRLLKEKEKKM
EDLRREKDAAEMLGAKIKAMESKLLVGGKNIVDHTNEQQKILEQKRQEIA
EQKRREREIQQQMESRDEETLELKETYSSLQQEVDIKTKKLKKLFSKLQA
VKAEIHDLQEEHIKERQELEQTQNELTRELKLKHLIIENFIPLEEKSKIM
NRAFFDEEEDHWKLHPITRLENQQMMKRPVSAVGYKRPLSQHARMSMMIR
PEARYRAENIVLLELDMPSRTTRDYEGPAIAPKVQAALDAALQDEDEIQV
DASSFESTANKKSKARPKSGRKSGSSSSSSGTPASQLYPQSRGLVPK

Кодований геном білок за функцією належить до білкових моторів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, клітинних відростках.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Shimizu K., Shirataki H., Honda T., Minami S., Takai Y. (1998). Complex formation of SMAP/KAP3, a KIF3A/B ATPase motor-associated protein, with a human chromosome-associated polypeptide.. J. Biol. Chem. 273: 6591 — 6594.  PubMed DOI:10.1074/jbc.273.12.6591

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6320 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O15066 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]