KIF5A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF5A
Protein KIF5A PDB 2kin.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIF5A, D12S1889, MY050, NKHC, SPG10, kinesin family member 5A, NEIMY, ALS25
Зовнішні ІД OMIM: 602821 MGI: 109564 HomoloGene: 55861 GeneCards: KIF5A
Пов'язані генетичні захворювання
Ревматоїдний артрит, hereditary spastic paraplegia 10[1]
Шаблон експресії
PBB GE KIF5A 205318 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004984
NM_001354705
NM_001039000
NM_008447
RefSeq (білок)
NP_004975
NP_001341634
NP_001034089
NP_032473
Локус (UCSC) Хр. 12: 57.55 – 57.59 Mb Хр. 10: 127.23 – 127.26 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF5A (англ. Kinesin family member 5A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 032 амінокислот, а молекулярна маса — 117 378[5].

Послідовність амінокислот
1020304050
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFD
RVFPPNTTQEQVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKL
HDPQLMGIIPRIARDIFNHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVT
KTNLSVHEDKNRVPFVKGCTERFVSSPEEILDVIDEGKSNRHVAVTNMNE
HSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVSKTGAEGAVLD
EAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEK
EKTKAQKETIAKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVN
DNSSIVVRIAPEERQKYEEEIRRLYKQLDDKDDEINQQSQLIEKLKQQML
DQEELLVSTRGDNEKVQRELSHLQSENDAAKDEVKEVLQALEELAVNYDQ
KSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVSGHQRKRIAEV
LNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSV
ELKKRHLEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALE
LQMESHREAHHRQLARLRDEINEKQKTIDELKDLNQKLQLELEKLQADYE
KLKSEEHEKSTKLQELTFLYERHEQSKQDLKGLEETVARELQTLHNLRKL
FVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQLTKVHKQLVRD
NADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSL
FQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNA
TDINDNRSDLPCGYEAEDQAKLFPLHQETAAS

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Niclas J., Navone F., Hom-Booher N., Vale R.D. (1994). Cloning and localization of a conventional kinesin motor expressed exclusively in neurons.. Neuron 12: 1059 — 1072.  PubMed DOI:10.1016/0896-6273(94)90314-X
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Blair M.A., Ma S., Hedera P. (2006). Mutation in KIF5A can also cause adult-onset hereditary spastic paraplegia.. Neurogenetics 7: 47 — 50.  PubMed DOI:10.1007/s10048-005-0027-8
  • DaRe J.T., Vasta V., Penn J., Tran N.T., Hahn S.H. (2013). Targeted exome sequencing for mitochondrial disorders reveals high genetic heterogeneity.. BMC Med. Genet. 14: 118 — 118.  PubMed DOI:10.1186/1471-2350-14-118

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]