KIF5C

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF5C
Protein KIF5C PDB 2kin.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIF5C, CDCBM2, KINN, NKHC, NKHC-2, NKHC2, kinesin family member 5C
Зовнішні ІД OMIM: 604593 MGI: 1098269 HomoloGene: 56234 GeneCards: KIF5C
Пов'язані генетичні захворювання
complex cortical dysplasia with other brain malformations 2[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004522
NM_008449
RefSeq (білок)
NP_004513
NP_032475
Локус (UCSC) Хр. 2: 148.88 – 149.03 Mb Хр. 2: 49.62 – 49.77 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF5C (англ. Kinesin family member 5C) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 957 амінокислот, а молекулярна маса — 109 495[5].

Послідовність амінокислот
1020304050
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFD
RVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKL
HDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVS
KTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNE
HSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVSKTGAEGAVLD
EAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEK
EKNKTLKNVIQHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIID
NIAPVVAGISTEEKEKYDEEISSLYRQLDDKDDEINQQSQLAEKLKQQML
DQDELLASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQALEELAVNYDQ
KSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEI
LNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKS
LVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNM
EQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMK
KALEQQMESHREAHQKQLSRLRDEIEEKQKIIDEIRDLNQKLQLEQEKLS
SDYNKLKIEDQEREMKLEKLLLLNDKREQAREDLKGLEETVSRELQTLHN
LRKLFVQDLTTRVKKSVELDNDDGGGSAAQKQKISFLENNLEQLTKVHKQ
LVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQE
VDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSS
NSTHYQK

Кодований геном білок за функцією належить до білкових моторів. Задіяний у таких біологічних процесах як транспорт, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Brickley K., Smith M.J., Beck M., Stephenson F.A. (2005). GRIF-1 and OIP106, members of a novel gene family of coiled-coil domain proteins: association in vivo and in vitro with kinesin.. J. Biol. Chem. 280: 14723 — 14732.  PubMed DOI:10.1074/jbc.M409095200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]