KIFC3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIFC3
Protein KIFC3 PDB 2h58.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIFC3, kinesin family member C3
Зовнішні ІД OMIM: 604535 MGI: 109202 HomoloGene: 124421 GeneCards: KIFC3
Шаблон експресії
PBB GE KIFC3 209661 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
NP_001139303
NP_001139304
NP_034761
Локус (UCSC) Хр. 16: 57.76 – 57.86 Mb Хр. 8: 95.1 – 95.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIFC3 (англ. Kinesin family member C3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 833 амінокислот, а молекулярна маса — 92 775[4].

Послідовність амінокислот
1020304050
MVPSRRTWNLGATPSLRGLWRVGRAPEPEPGMARPAPAPASPAARPFPHT
GPGRLRTGRGKDTPVCGDEDSSARSAARPALAQCRALSVDWAGPGSPHGL
YLTLQVEHLKEKLISQAQEVSRLRSELGGTDLEKHRDLLMVENERLRQEM
RRCEAELQELRTKPAGPCPGCEHSQESAQLRDKLSQLQLEMAESKGMLSE
LNLEVQQKTDRLAEVELRLKDCLAEKAQEEERLSRRLRDSHETIASLRAQ
SPPVKYVIKTVEVESSKTKQALSESQARNQHLQEQVAMQRQVLKEMEQQL
QSSHQLTARLRAQIAMYESELERAHGQMLEEMQSLEEDKNRAIEEAFARA
QVEMKAVHENLAGVRTNLLTLQPALRTLTNDYNGLKRQVRGFPLLLQEAL
RSVKAEIGQAIEEVNSNNQELLRKYRRELQLRKKCHNELVRLKGNIRVIA
RVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQA
SQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENPGINQR
ALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCP
DGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHAL
LIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKS
LSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEK
NTSETLYSLKFAERVRSVELGPGLRRAELGSWSSQEHLEWEPACQTPQPS
ARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, мембрані, клітинних контактах, цитоплазматичних везикулах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hoang E.H., Whitehead J.L., Dose A.C., Burnside B. (1998). Cloning of a novel C-terminal kinesin (KIFC3) that maps to human chromosome 16q13-q21 and thus is a candidate gene for Bardet-Biedl syndrome.. Genomics 52: 219 — 222.  PubMed DOI:10.1006/geno.1998.5431
  • Meng W., Mushika Y., Ichii T., Takeichi M. (2008). Anchorage of microtubule minus ends to adherens junctions regulates epithelial cell-cell contacts.. Cell 135: 948 — 959.  PubMed DOI:10.1016/j.cell.2008.09.040

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6326 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9BVG8 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]