Кератин-12

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з KRT12)
Перейти до навігації Перейти до пошуку
KRT12
Ідентифікатори
Символи KRT12, K12, keratin 12
Зовнішні ІД OMIM: 601687 MGI: 96687 HomoloGene: 188 GeneCards: KRT12
Пов'язані генетичні захворювання
Meesmann corneal dystrophy[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000223
NM_010661
RefSeq (білок)
NP_000214
NP_034791
Локус (UCSC) Хр. 17: 40.86 – 40.87 Mb Хр. 11: 99.42 – 99.42 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT12 (англ. Keratin 12) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 494 амінокислот, а молекулярна маса — 53 511[5].

Послідовність амінокислот
1020304050
MDLSNNTMSLSVRTPGLSRRLSSQSVIGRPRGMSASSVGSGYGGSAFGFG
ASCGGGFSAASMFGSSSGFGGGSGSSMAGGLGAGYGRALGGGSFGGLGMG
FGGSPGGGSLGILSGNDGGLLSGSEKETMQNLNDRLASYLDKVRALEEAN
TELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNKIISASIGNAQL
LLQIDNARLAAEDFRMKYENELALRQGVEADINGLRRVLDELTLTRTDLE
MQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLND
MRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRR
AFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQ
VRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTD
SKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM

Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Yoon M.K., Warren J.F., Holsclaw D.S., Gritz D.C., Margolis T.P. (2004). A novel arginine substitution mutation in 1A domain and a novel 27 bp insertion mutation in 2B domain of keratin 12 gene associated with Meesmann's corneal dystrophy.. Br. J. Ophthalmol. 88: 752 — 756.  PubMed DOI:10.1136/bjo.2003.032870
  • Chen Y.T., Tseng S.H., Chao S.C. (2005). Novel mutations in the helix termination motif of keratin 3 and keratin 12 in 2 Taiwanese families with Meesmann corneal dystrophy.. Cornea 24: 928 — 932.  PubMed DOI:10.1097/01.ico.0000159732.29930.26
  • Nichini O., Manzi V., Munier F.L., Schorderet D.F. (2005). Meesmann corneal dystrophy (MECD): report of 2 families and a novel mutation in the cornea specific keratin 12 (KRT12) gene.. Ophthalmic Genet. 26: 169 — 173.  PubMed DOI:10.1080/13816810500374391
  • Nielsen K., Orntoft T., Hjortdal J., Rasmussen T., Ehlers N. (2008). A novel mutation as the basis for asymptomatic meesmann dystrophy in a Danish family.. Cornea 27: 100 — 102.  PubMed DOI:10.1097/ICO.0b013e31815652fd
  • Clausen I., Duncker G.I., Grunauer-Kloevekorn C. (2010). Identification of a novel mutation in the cornea specific keratin 12 gene causing Meesmann's corneal dystrophy in a German family.. Mol. Vis. 16: 954 — 960.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]