KRT13

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT13
Ідентифікатори
Символи KRT13, CK13, K13, WSN2, keratin 13
Зовнішні ІД OMIM: 148065 MGI: 101925 HomoloGene: 40740 GeneCards: KRT13
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_153490
NM_002274
NM_010662
NM_001313949
RefSeq (білок)
NP_002265
NP_705694
NP_001300878
NP_034792
Локус (UCSC) Хр. 17: 41.5 – 41.51 Mb Хр. 11: 100.12 – 100.12 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT13 (англ. Keratin 13) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 458 амінокислот, а молекулярна маса — 49 588[4].

Послідовність амінокислот
1020304050
MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVS
CGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDGGLL
TGNEKITMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPER
DYSPYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELAL
RQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEF
SNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHTKS
AELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVA
ETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQ
EIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGR
RTSDVRRP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Schulz P., Wachter E., Hochstrasser K., Wild A.G., Mischke D. (1989). Sequence of a human keratin 13 specific cDNA encompassing coil 1B through the 3' end.. Biochem. Biophys. Res. Commun. 162: 1522 — 1527.  PubMed DOI:10.1016/0006-291X(89)90847-4
  • Mischke D., Schulz P., Wild A.G. (1989). The N-, but not the C-terminal domains of human keratins 13 and 15 are closely related.. Nucleic Acids Res. 17: 7984 — 7984.  PubMed DOI:10.1093/nar/17.19.7984
  • Kuruc N., Leube R.E., Moll I., Bader B.L., Franke W.W. (1989). Synthesis of cytokeratin 13, a component characteristic of internal stratified epithelia, is not induced in human epidermal tumors.. Differentiation 42: 111 — 123.  PubMed DOI:10.1111/j.1432-0436.1989.tb00612.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Richard G., de Laurenzi V., Didona B., Bale S.J., Compton J.G. (1995). Keratin 13 point mutation underlies the hereditary mucosal epithelial disorder white sponge nevus.. Nat. Genet. 11: 453 — 455.  PubMed DOI:10.1038/ng1295-453
  • Shibuya Y., Zhang J., Yokoo S., Umeda M., Komori T. (2003). Constitutional mutation of keratin 13 gene in familial white sponge nevus.. Oral Surg. Oral Med. Oral Pathol. Oral Radiol. Endod. 96: 561 — 565.  PubMed DOI:10.1016/S1079-2104(03)00372-X

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6415 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P13646 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]