KRT26

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT26
Ідентифікатори
Символи KRT26, CK26, K25IRS2, K26, KRT25B, K25, keratin 26
Зовнішні ІД OMIM: 616675 MGI: 2444913 HomoloGene: 37118 GeneCards: KRT26
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_181539
NM_001033397
RefSeq (білок)
NP_853517
NP_001028569
Локус (UCSC) Хр. 17: 40.77 – 40.77 Mb Хр. 11: 99.33 – 99.34 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT26 (англ. Keratin 26) – білок, який кодується однойменним геном, розташованим у людей на 17-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 468 амінокислот, а молекулярна маса — 51 911[4].

Послідовність амінокислот
1020304050
MSFRLSGGSRRICSRTGSGRLSGGGTGFVAGNVCVGSGARSSFSCTLEGI
SSGGSFCNSGGGLGSGACAGFLGNEHSLLSGNEKVTMQNLNDRLASYLDH
VHALEEANADLEQKIKGWYEKCEPGSSREHDHDYSRYFSVIEDLKRQIIS
ATICNASIVLQNDNARLTADDFRLKYENELALHHSVEADTSGLRRVLDEL
TLCTTDLEIQCETLSEELTYLKKSHEEEMEVLQYTAGGNVNVEMNATPGV
DLTVLLNNMRAEYEDLAEQNRKDAEAWFNERSATLQQQISDHEGAATAAR
NELTELKRNLQTLEIELQSLMAVKHSYECSLAETEGNYCNQLQQIQDQIG
VMEEQLQQIRTETEGQKLEYEQLLDVKIFLEKEIDIYCNLLDGEERKSKS
TCYKSKGYRPVNSGNQAKDSTEETIVKTVVEELDQIGNLLSLRVHSVEEK
SSKISNITVEQRVPSKAP

Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Rogers M.A., Winter H., Langbein L., Bleiler R., Schweizer J. (2004). The human type I keratin gene family: characterization of new hair follicle specific members and evaluation of the chromosome 17q21.2 gene domain.. Differentiation 72: 527 — 540.  PubMed DOI:10.1111/j.1432-0436.2004.07209006.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:30840 (англ.). Процитовано 21 вересня 2017. 
  4. UniProt, Q7Z3Y9 (англ.). Процитовано 21 вересня 2017. 

Див. також[ред. | ред. код]