KRT33B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT33B
Ідентифікатори
Символи KRT33B, HA3II, Ha-3II, K33B, KRTHA3A, KRTHA3B, hHa3-II, keratin 33B
Зовнішні ІД OMIM: 602762 HomoloGene: 136754 GeneCards: KRT33B
Шаблон експресії
PBB GE KRT33B 207787 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002279
н/д
RefSeq (білок)
NP_002270
н/д
Локус (UCSC) Хр. 17: 41.36 – 41.37 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

KRT33B (англ. Keratin 33B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 404 амінокислот, а молекулярна маса — 46 214[3].

Послідовність амінокислот
1020304050
MPYNFCLPSLSCRTSCSSRPCVPPSCHGYTLPGACNIPANVSNCNWFCEG
SFNGSEKETMQFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLLC
PSYQSYFKTIEELQQKILCSKSENARLVVQIDNAKLAADDFRTKYQTEQS
LRQLVESDINSLRRILDELTLCRSDLEAQMESLKEELLSLKQNHEQEVNT
LRCQLGDRLNVEVDAAPAVDLNQVLNETRNQYEALVETNRREVEQWFATQ
TEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRYSLENTL
TESEARYSSQLSQVQSLITNVESQLAEIRSDLERQNQEYQVLLDVRARLE
CEINTYRSLLESEDCKLPSNPCATTNACEKPIGSCVTNPCGPRSRCGPCN
TFGY

Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Rogers M.A., Winter H., Wolf C., Heck M., Schweizer J. (1998). Characterization of a 190-kilobase pair domain of human type I hair keratin genes.. J. Biol. Chem. 273: 26683 — 26691.  PubMed DOI:10.1074/jbc.273.41.26683
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rogers M.A., Schweizer J., Kreig T., Winter H. (1994). A novel human type I hair keratin gene: evidence for two keratin hHa3 isoforms.. Mol. Biol. Rep. 20: 155 — 161.  PubMed DOI:10.1007/BF00990548

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:6451 (англ.). Процитовано 12 вересня 2017. 
  3. UniProt, Q14525 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]