KRT34

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT34
Ідентифікатори
Символи KRT34, HA4, Ha-4, KRTHA4, hHa4, Keratin 34
Зовнішні ІД OMIM: 602763 MGI: 1309994 HomoloGene: 31083 GeneCards: KRT34
Шаблон експресії
PBB GE KRT34 206969 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021013
NM_027563
RefSeq (білок)
NP_066293
NP_081839
Локус (UCSC) Хр. 17: 41.38 – 41.38 Mb Хр. 11: 100.04 – 100.04 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT34 (англ. Keratin 34) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 436 амінокислот, а молекулярна маса — 49 424[4].

Послідовність амінокислот
1020304050
MLYAKPPPTINGIKGLQRKERLKPAHIHLQQLTCFSITCSSTMSYSCCLP
SLGCRTSCSSRPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKE
TMQFLNDRLASYLEKVRQLERDNAELEKLIQERSQQQEPLLCPSYQSYFK
TIEELQQKILCAKAENARLVVNIDNAKLASDDFRSKYQTEQSLRLLVESD
INSIRRILDELTLCKSDLESQVESLREELICLKKNHEEEVNTLRSQLGDR
LNVEVDTAPTVDLNQVLNETRSQYEALVEINRREVEQWFATQTEELNKQV
VSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTLTESEAHYS
SQLSQVQSLITNVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRS
LLESEDCKLPCNPCATTNASGNSCGPCGTSQKGCCN

Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Rogers M.A., Winter H., Wolf C., Heck M., Schweizer J. (1998). Characterization of a 190-kilobase pair domain of human type I hair keratin genes.. J. Biol. Chem. 273: 26683 — 26691.  PubMed DOI:10.1074/jbc.273.41.26683
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6452 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O76011 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]