KRT35

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT35
Ідентифікатори
Символи KRT35, HA5, Ha-5, KRTHA5, hHa5, keratin 35, K35
Зовнішні ІД OMIM: 602764 MGI: 1858899 HomoloGene: 1715 GeneCards: KRT35
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002280
NM_016880
RefSeq (білок)
NP_002271
NP_058576
Локус (UCSC) Хр. 17: 41.48 – 41.48 Mb Хр. 11: 100.09 – 100.1 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT35 (англ. Keratin 35) – білок, який кодується однойменним геном, розташованим у людей на довгому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 455 амінокислот, а молекулярна маса — 50 361[4].

Послідовність амінокислот
1020304050
MASKCLKAGFSSGSLKSPGGASGGSTRVSAMYSSSSCKLPSLSPVARSFS
ACSVGLGRSSYRATSCLPALCLPAGGFATSYSGGGGWFGEGILTGNEKET
MQSLNDRLAGYLEKVRQLEQENASLESRIREWCEQQVPYMCPDYQSYFRT
IEELQKKTLCSKAENARLVVEIDNAKLAADDFRTKYETEVSLRQLVESDI
NGLRRILDDLTLCKSDLEAQVESLKEELLCLKKNHEEEVNSLRCQLGDRL
NVEVDAAPPVDLNRVLEEMRCQYETLVENNRRDAEDWLDTQSEELNQQVV
SSSEQLQSCQAEIIELRRTVNALEIELQAQHSMRDALESTLAETEARYSS
QLAQMQCMITNVEAQLAEIRADLERQNQEYQVLLDVRARLECEINTYRGL
LESEDSKLPCNPCAPDYSPSKSCLPCLPAASCGPSAARTNCSPRPICVPC
PGGRF

Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Rogers M.A., Winter H., Langbein L., Krieg T., Schweizer J. (1996). Genomic characterization of the human type I cuticular hair keratin hHa2 and identification of an adjacent novel type I hair keratin gene hHa5.. J. Invest. Dermatol. 107: 633 — 638.  PubMed DOI:10.1111/1523-1747.ep12584243
  • Rogers M.A., Winter H., Wolf C., Heck M., Schweizer J. (1998). Characterization of a 190-kilobase pair domain of human type I hair keratin genes.. J. Biol. Chem. 273: 26683 — 26691.  PubMed DOI:10.1074/jbc.273.41.26683

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6453 (англ.). Процитовано 21 вересня 2017. 
  4. UniProt, Q92764 (англ.). Процитовано 21 вересня 2017. 

Див. також[ред. | ред. код]