KRT36

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT36
Ідентифікатори
Символи KRT36, HA6, KRTHA6, hHa6, keratin 36
Зовнішні ІД OMIM: 604540 MGI: 109364 HomoloGene: 88459 GeneCards: KRT36
Шаблон експресії
PBB GE KRT36 214576 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003771
NM_001174099
NM_008472
RefSeq (білок)
NP_003762
NP_001167570
Локус (UCSC) Хр. 17: 41.49 – 41.49 Mb Хр. 11: 100.1 – 100.11 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT36 (англ. Keratin 36) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 467 амінокислот, а молекулярна маса — 52 247[4].

Послідовність амінокислот
1020304050
MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYIS
SARSGLSGLGSCLPGSYLSSECHTSGFVGSGGWFCEGSFNGSEKETMQFL
NDRLANYLEKVRQLERENAELESRIQEWYEFQIPYICPDYQSYFKTIEDF
QQKILLTKSENARLVLQIDNAKLAADDFRTKYETELSLRQLVEADINGLR
RILDELTLCKADLEAQVESLKEELMCLKKNHEEEVSVLRCQLGDRLNVEV
DAAPPVDLNKILEDMRCQYEALVENNRRDVEAWFNTQTEELNQQVVSSSE
QLQCCQTEIIELRRTVNALEIELQAQHSMRNSLESTLAETEARYSSQLAQ
MQCLISNVEAQLSEIRCDLERQNQEYQVLLDVKARLEGEIATYRHLLEGE
DCKLPPQPCATACKPVIRVPSVPPVPCVPSVPCTPAPQVGTQIRTITEEI
RDGKVISSREHVQSRPL

Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Rogers M.A., Winter H., Wolf C., Heck M., Schweizer J. (1998). Characterization of a 190-kilobase pair domain of human type I hair keratin genes.. J. Biol. Chem. 273: 26683 — 26691.  PubMed DOI:10.1074/jbc.273.41.26683
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6454 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O76013 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]