KRT39

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT39
Ідентифікатори
Символи KRT39, CK-39, K39, KA35, keratin 39
Зовнішні ІД OMIM: 616678 MGI: 3588208 HomoloGene: 19078 GeneCards: KRT39
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_213656
NM_213730
RefSeq (білок)
NP_998821
NP_998895
Локус (UCSC) Хр. 17: 40.96 – 40.97 Mb Хр. 11: 99.51 – 99.52 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT39 (англ. Keratin 39) – білок, який кодується однойменним геном, розташованим у людей на 17-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 491 амінокислот, а молекулярна маса — 55 651[4].

Послідовність амінокислот
1020304050
MDTKGCTTTNSPSTPCQNCSRITNVSTISSNNGCHPGGLTVNNCQPAGHV
LRIPWDQGCQPTPRFCRKPIYLMNNFNARFSLDDCSWYGEGINSNEKETM
QILNERLANYLQKVRMLERENAELESKIQEESNKELPVLCPDYLSYYTTI
EELQQKILCTKAENSRLVSQIDNTKLTADDLRAKYEAEVSLRQLVESDAN
GLKQILNVLTLGKADLEAQVQSLKEELLCLKNNHKEEINSLQCQLGERLD
IEVTAAPSADLNQVLQEMRCQYEPIMETNRKDVEQWFNTQIEELNQQVVT
SSQQQQCCQKEIIELRRSVNTLEVELQAQHRMRDSQECILTETEARYTAL
LTQIQSLIDNLEAQLAEIRCALERQNQEYEILLDVKSRLECEITTYRSLL
ESSDGKRPCYPRATKCEPSPWTSCKSGAIESTAPACTSSSPCSLKEHCSA
CGPLSRILVKICTITKEIKDGKVISSYEHVQPCFIIRPAKV

Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Rogers M.A., Winter H., Langbein L., Bleiler R., Schweizer J. (2004). The human type I keratin gene family: characterization of new hair follicle specific members and evaluation of the chromosome 17q21.2 gene domain.. Differentiation 72: 527 — 540.  PubMed DOI:10.1111/j.1432-0436.2004.07209006.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hesse M., Zimek A., Weber K., Magin T.M. (2004). Comprehensive analysis of keratin gene clusters in humans and rodents.. Eur. J. Cell Biol. 83: 19 — 26.  PubMed DOI:10.1078/0171-9335-00354

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:32971 (англ.). Процитовано 21 вересня 2017. 
  4. UniProt, Q6A163 (англ.). Процитовано 21 вересня 2017. 

Див. також[ред. | ред. код]