KRT74

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT74
Ідентифікатори
Символи KRT74, ADWH, HTSS2, HYPT3, K6IRS4, KRT5C, KRT6IRS4, keratin 74
Зовнішні ІД OMIM: 608248 HomoloGene: 45489 GeneCards: KRT74
Пов'язані генетичні захворювання
hypotrichosis 3[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_175053
н/д
RefSeq (білок)
NP_778223
н/д
Локус (UCSC) Хр. 12: 52.57 – 52.57 Mb н/д
PubMed search [2] н/д
Вікідані
Див./Ред. для людей

KRT74 (англ. Keratin 74) – білок, який кодується однойменним геном, розташованим у людей на 12-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 529 амінокислот, а молекулярна маса — 57 865[4].

Послідовність амінокислот
1020304050
MSRQLNIKSSGDKGNFSVHSAVVPRKAVGSLASYCAAGRGAGAGFGSRSL
YSLGGNRRISFNVAGGGVRAGGYGFRPGSGYGGGRASGFAGSMFGSVALG
PACLSVCPPGGIHQVTVNKSLLAPLNVELDPEIQKVRAQEREQIKVLNDK
FASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKKNLEPILEGYISNLRK
QLETLSGDRVRLDSELRSMRDLVEDYKKRYEVEINRRTTAENEFVVLKKD
ADAAYAVKVELQAKVDSLDKEIKFLKCLYDAEIAQIQTHASETSVILSMD
NNRDLDLDSIIAEVRMHYEEIALKSKAEAEALYQTKIQELQLAASRHGDD
LKHTRSEMVELNRLIQRIRCEIGNVKKQRASLETAIADAEQRGDNALKDA
QAKLDELEGALHQAKEELARMLREYQELMSLKLALDMEIATYRKLLEGEE
CRMSGENPSSVSISVISSSSYSYHHPSSAGVDLGASAVAGSSGSTQSGQT
KTTEARGGDLKDTQGKSTPASIPARKATR

Кодований геном білок за функцією належить до фосфопротеїнів. Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Langbein L., Rogers M.A., Praetzel S., Winter H., Schweizer J. (2003). K6irs1, K6irs2, K6irs3, and K6irs4 represent the inner-root-sheath-specific type II epithelial keratins of the human hair follicle.. J. Invest. Dermatol. 120: 512 — 522.  PubMed DOI:10.1046/j.1523-1747.2003.12087.x
  • Shimomura Y., Wajid M., Petukhova L., Kurban M., Christiano A.M. (2010). Autosomal-dominant woolly hair resulting from disruption of keratin 74 (KRT74), a potential determinant of human hair texture.. Am. J. Hum. Genet. 86: 632 — 638.  PubMed DOI:10.1016/j.ajhg.2010.02.025
  • Hesse M., Magin T.M., Weber K. (2001). Genes for intermediate filament proteins and the draft sequence of the human genome: novel keratin genes and a surprisingly high number of pseudogenes related to keratin genes 8 and 18.. J. Cell Sci. 114: 2569 — 2575.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]