LAMA1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
LAMA1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи LAMA1, LAMA, S-LAM-alpha, PTBHS, Laminin, alpha 1, laminin subunit alpha 1
Зовнішні ІД MGI: 99892 HomoloGene: 21146 GeneCards: LAMA1
Пов'язані генетичні захворювання
Цукровий діабет 2-го типу[1]
Шаблон експресії
PBB GE LAMA1 gnf1h07866 at fs.png

PBB GE LAMA1 gnf1h03218 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005559
NM_008480
RefSeq (білок)
NP_005550
NP_032506
Локус (UCSC) Хр. 18: 6.94 – 7.12 Mb Хр. 17: 67.7 – 67.82 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

LAMA1 (англ. Laminin subunit alpha 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 3 075 амінокислот, а молекулярна маса — 337 084[5].

Послідовність амінокислот
1020304050
MRGGVLLVLLLCVAAQCRQRGLFPAILNLASNAHISTNATCGEKGPEMFC
KLVEHVPGRPVRNPQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQN
GREYHWVTITLDLRQVFQVAYVIIKAANAPRPGNWILERSLDGTTFSPWQ
YYAVSDSECLSRYNITPRRGPPTYRADDEVICTSYYSRLVPLEHGEIHTS
LINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMTLSHREPKELD
PIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGES
CNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLN
TAGQFRGGGVCINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCD
PVGSLSSVCIKDDLHSDLHNGKQPGQCPCKEGYTGEKCDRCQLGYKDYPT
CVSCGCNPVGSASDEPCTGPCVCKENVEGKACDRCKPGFYNLKEKNPRGC
SECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIPSQQDALGGRH
QVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETV
DSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHS
KRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDL
VVAADVEHCECPQGYTGTSCESCLSGYYRVDGILFGGICQPCECHGHAAE
CNVHGVCIACAHNTTGVHCEQCLPGFYGEPSRGTPGDCQPCACPLTIASN
NFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPTVPGESCVPCD
CSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCR
ACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRP
CNCSVAGSVSDGCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDC
PHTQNTCDPETGECVCPPHTQGVKCEECEDGHWGYDAEVGCQACNCSLVG
STHHRCDVVTGHCQCKSKFGGRACDQCSLGYRDFPDCVPCDCDLRGTSGD
ACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALRADNPLGCSPC
FCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPD
FLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVG
TSNFEPQVLIKGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSV
SEKPVTREDFMSVLSDIEYILIKASYGQGLQQSRISDISMEVGRKAEKLH
PEEEVASLLENCVCPPGTVGFSCQDCAPGYHRGKLPAGSDRGPRPLVAPC
VPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYGKVTGSASDCA
LCACPHSPPASFSPTCVLEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQ
TPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILME
TDCVSCDDECVGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTKY
LQESLLKENMQKDLGKIKLEGVAEETDNLQKKLTRMLASTQKVNRATERI
FKESQDLAIAIERLQMSITEIMEKTTLNQTLDEDFLLPNSTLQNMQQNGT
SLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPLEELEVLKEAA
SHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQ
EEQNLTSELIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRH
HIDDLVMHMSQRNAVDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNAT
SAAYVHYNIQSLIEESEELARDAHRTVTETSLLSESLVSNGKAAVQRSSR
FLKEGNNLSRKLPGIALELSELRNKTNRFQENAVEITRQTNESLLILRAI
PKGIRDKGAKTKELATSASQSAVSTLRDVAGLSQELLNTSASLSRVNTTL
RETHQLLQDSTMATLLAGRKVKDVEIQANLLFDRLKPLKMLEENLSRNLS
EIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQE
PDNLLFYLGSSTASDFLAVEMRRGRVAFLWDLGSGSTRLEFPDFPIDDNR
WHSIHVARFGNIGSLSVKEMSSNQKSPTKTSKSPGTANVLDVNNSTLMFV
GGLGGQIKKSPAVKVTHFKGCLGEAFLNGKSIGLWNYIEREGKCRGCFGS
SQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNTFSPNGLLLYLGSYGT
KDFLSIELFRGRVKVMTDLGSGPITLLTDRRYNNGTWYKIAFQRNRKQGV
LAVIDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVT
TKSFVGCIKNLEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELP
PKSLSPESEWLVTFATTNSSGIILAALGGDVEKRGDREEAHVPFFSVMLI
GGNIEVHVNPGDGTGLRKALLHAPTGTCSDGQAHSISLVRNRRIITVQLD
ENNPVEMKLGTLVESRTINVSNLYVGGIPEGEGTSLLTMRRSFHGCIKNL
IFNLELLDFNSAVGHEQVDLDTCWLSERPKLAPDAEDSKLLPEPRAFPEQ
CVVDAALEYVPGAHQFGLTQNSHFILPFNQSAVRKKLSVELSIRTFASSG
LIYYMAHQNQADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTV
KTDYVKRKGFITVDGRESPMVTVVGDGTMLDVEGLFYLGGLPSQYQARKI
GNITHSIPACIGDVTVNSKQLDKDSPVSAFTVNRCYAVAQEGTYFDGSGY
AALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAKVDAIGLELVDGKVL
FHVNNGAGRITAAYEPKTATVLCDGKWHTLQANKSKHRITLIVDGNAVGA
ESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQTSFRGCLRKLALIKSPQ
VQSFDFSRAFELHGVFLHSCPGTES

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як клітинна адгезія. Локалізований у позаклітинному матриксі, базальній мембрані. Також секретований назовні.

Література[ред. | ред. код]

  • Nissinen M., Vuolteenaho R., Boot-Handford R., Kallunki P., Tryggvason K. (1991). Primary structure of the human laminin A chain. Limited expression in human tissues.. Biochem. J. 276: 369 — 379.  PubMed DOI:10.1042/bj2760369
  • Haaparanta T., Uitto J., Ruoslahti E., Engvall E. (1991). Molecular cloning of the cDNA encoding human laminin A chain.. Matrix 11: 151 — 160.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]