LMBR1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
LMBR1
Ідентифікатори
Символи LMBR1, ACHP, C7orf2, DIF14, PPD2, TPT, ZRS, LSS, THYP, limb development membrane protein 1
Зовнішні ІД OMIM: 605522 MGI: 1861746 HomoloGene: 49706 GeneCards: LMBR1
Пов'язані генетичні захворювання
acheiropody, Laurin-Sandrow syndrome[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_020295
RefSeq (білок)
NP_064691
Локус (UCSC) Хр. 7: 156.67 – 156.89 Mb Хр. 5: 29.23 – 29.38 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

LMBR1 (англ. Limb development membrane protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 490 амінокислот, а молекулярна маса — 55 098[5].

Послідовність амінокислот
1020304050
MEGQDEVSAREQHFHSQVRESTICFLLFAILYVVSYFIITRYKRKSDEQE
DEDAIVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLSFPQNYYIQWL
NGSLIHGLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLKKGIRARILET
LVMLLLLALLILGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLM
GCLLLLLCTPVGLSRMFTVMGQLLVKPTILEDLDEQIYIITLEEEALQRR
LNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERNLVYPAVMVL
LLIETSISVLLVACNILCLLVDETAMPKGTRGPGIGNASLSTFGFVGAAL
EIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSA
LPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIVTTLCLVRKF
TSAVREELFKALGLHKLHLPNTSRDSETAKPSVNGHQKAL

Кодований геном білок за функцією належить до рецепторів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Norbnop P., Srichomthong C., Suphapeetiporn K., Shotelersuk V. (2014). ZRS 406A>G mutation in patients with tibial hypoplasia, polydactyly and triphalangeal first fingers.. J. Hum. Genet. 59: 467 — 470.  PubMed DOI:10.1038/jhg.2014.50

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]