MADD

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MADD
Ідентифікатори
Символи MADD, DENN, IG20, RAB3GEP, MAP kinase activating death domain
Зовнішні ІД MGI: 2444672 HomoloGene: 14249 GeneCards: MADD
Шаблон експресії
PBB GE MADD 210252 s at fs.png

PBB GE MADD 38398 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
NP_001171190
NP_001171191
NP_663502
Локус (UCSC) Хр. 11: 47.27 – 47.33 Mb Хр. 2: 91.14 – 91.18 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MADD (англ. MAP kinase activating death domain) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 647 амінокислот, а молекулярна маса — 183 303[4].

Послідовність амінокислот
1020304050
MVQKKKFCPRLLDYLVIVGARHPSSDSVAQTPELLRRYPLEDHTEFPLPP
DVVFFCQPEGCLSVRQRRMSLRDDTSFVFTLTDKDTGVTRYGICVNFYRS
FQKRISKEKGEGGAGSRGKEGTHATCASEEGGTESSESGSSLQPLSADST
PDVNQSPRGKRRAKAGSRSRNSTLTSLCVLSHYPFFSTFRECLYTLKRLV
DCCSERLLGKKLGIPRGVQRDTMWRIFTGSLLVEEKSSALLHDLREIEAW
IYRLLRSPVPVSGQKRVDIEVLPQELQPALTFALPDPSRFTLVDFPLHLP
LELLGVDACLQVLTCILLEHKVVLQSRDYNALSMSVMAFVAMIYPLEYMF
PVIPLLPTCMASAEQLLLAPTPYIIGVPASFFLYKLDFKMPDDVWLVDLD
SNRVIAPTNAEVLPILPEPESLELKKHLKQALASMSLNTQPILNLEKFHE
GQEIPLLLGRPSNDLQSTPSTEFNPLIYGNDVDSVDVATRVAMVRFFNSA
NVLQGFQMHTRTLRLFPRPVVAFQAGSFLASRPRQTPFAEKLARTQAVEY
FGEWILNPTNYAFQRIHNNMFDPALIGDKPKWYAHQLQPIHYRVYDSNSQ
LAEALSVPPERDSDSEPTDDSGSDSMDYDDSSSSYSSLGDFVSEMMKCDI
NGDTPNVDPLTHAALGDASEVEIDELQNQKEAEEPGPDSENSQENPPLRS
SSSTTASSSPSTVIHGANSEPADSTEMDDKAAVGVSKPLPSVPPSIGKSN
VDRRQAEIGEGSVRRRIYDNPYFEPQYGFPPEEDEDEQGESYTPRFSQHV
SGNRAQKLLRPNSLRLASDSDAESDSRASSPNSTVSNTSTEGFGGIMSFA
SSLYRNHSTSFSLSNLTLPTKGAREKATPFPSLKVFGLNTLMEIVTEAGP
GSGEGNRRALVDQKSSVIKHSPTVKREPPSPQGRSSNSSENQQFLKEVVH
SVLDGQGVGWLNMKKVRRLLESEQLRVFVLSKLNRMVQSEDDARQDIIPD
VEISRKVYKGMLDLLKCTVLSLEQSYAHAGLGGMASIFGLLEIAQTHYYS
KEPDKRKRSPTESVNTPVGKDPGLAGRGDPKAMAQLRVPQLGPRAPSATG
KGPKELDTRSLKEENFIASIELWNKHQEVKKQKALEKQRPEVIKPVFDLG
ETEEKKSQISADSGVSLTSSSQRTDQDSVIGVSPAVMIRSSSQDSEVSTV
VSNSSGETLGADSDLSSNAGDGPGGEGSVHLASSRGTLSDSEIETNSATS
TIFGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLYEGLLGRDKGSMWDQL
EDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMID
RYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKVRRLM
GKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTD
TNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRR
NGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQD
LKTGEGGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPE
IKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPVSS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, альтернативний сплайсинг. Локалізований у цитоплазмі, мембрані.

Література[ред. | ред. код]

  • Chow V.T.K., Lee S.S. (1996). DENN, a novel human gene differentially expressed in normal and neoplastic cells.. DNA Seq. 6: 263 — 273.  PubMed DOI:10.3109/10425179609020873
  • Schievella A.R., Chen J.H., Graham J.R., Lin L.-L. (1997). MADD, a novel death domain protein that interacts with the type 1 tumor necrosis factor receptor and activates mitogen-activated protein kinase.. J. Biol. Chem. 272: 12069 — 12075.  PubMed DOI:10.1074/jbc.272.18.12069
  • Chow V.T.K., Lim K.M., Lim D. (1998). The human DENN gene: genomic organization, alternative splicing, and localization to chromosome 11p11.21-p11.22.. Genome 41: 543 — 552.  PubMed DOI:10.1139/g98-050
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Telliez J.-B., Bean K.M., Lin L.-L. (2000). LRDD, a novel leucine rich repeat and death domain containing protein.. Biochim. Biophys. Acta 1478: 280 — 288.  PubMed DOI:10.1016/S0167-4838(00)00029-7
  • Lim K.M., Yeo W.S., Chow V.T.K. (2004). Antisense abrogation of DENN expression induces apoptosis of leukemia cells in vitro, causes tumor regression in vivo and alters the transcription of genes involved in apoptosis and the cell cycle.. Int. J. Cancer 109: 24 — 37.  PubMed DOI:10.1002/ijc.11660

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6766 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q8WXG6 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]