MAPT

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MAPT
Ідентифікатори
Символи tau proteinPHF-taupaired helical filament-tauG protein beta1/gamma2 subunit-interacting factor 1microtubule-associated protein tauMAPTprotein phosphatase 1regulatory subunit 103tau proteinsneurofibrillary tangle protein
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE MAPT 203929 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

MAPT (англ. Microtubule associated protein tau) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 758 амінокислот, а молекулярна маса — 78 928[2].

Послідовність амінокислот
1020304050
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT
PTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG
TTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREPGPPGLSHQLM
SGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEG
PPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAA
REATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEAD
LPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSS
AKTLKNRPCLSPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTG
SSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPP
SSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPP
KSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPG
GGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAK
AKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVS
ASLAKQGL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних відростках.

Література[ред. | ред. код]

  • Goedert M., Wischik C., Crowther R., Walker J., Klug A. (1988). Cloning and sequencing of the cDNA encoding a core protein of the paired helical filament of Alzheimer disease: identification as the microtubule-associated protein tau.. Proc. Natl. Acad. Sci. U.S.A. 85: 4051 — 4055.  PubMed DOI:10.1073/pnas.85.11.4051
  • Lee G., Neve R.L., Kosik K.S. (1989). The microtubule binding domain of tau protein.. Neuron 2: 1615 — 1624.  PubMed DOI:10.1016/0896-6273(89)90050-0
  • Goedert M., Spillantini M.G., Jakes R., Rutherford D., Crowther R.A. (1989). Multiple isoforms of human microtubule-associated protein tau: sequences and localization in neurofibrillary tangles of Alzheimer's disease.. Neuron 3: 519 — 526.  PubMed DOI:10.1016/0896-6273(89)90210-9
  • Andreadis A., Brown W.M., Kosik K.S. (1992). Structure and novel exons of the human tau gene.. Biochemistry 31: 10626 — 10633.  PubMed DOI:10.1021/bi00158a027
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lee V.M., Balin B.J., Otvos L. Jr., Trojanowski J.Q. (1991). A68: a major subunit of paired helical filaments and derivatized forms of normal Tau.. Science 251: 675 — 678.  PubMed DOI:10.1126/science.1899488

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:6893 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, P10636 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]