MITF

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MITF
Ідентифікатори
Символи microphtalmia-associated transcription factorclass E basic helix-loop-helix protein 32melanogenesis associated transcription factormicrophthalmia-associated transcription factorbHLHe32MITF
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE MITF 207233 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

MITF (англ. Melanogenesis associated transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 526 амінокислот, а молекулярна маса — 58 795[2].

Послідовність амінокислот
1020304050
MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISS
SSMTSRILLRQQLMREQMQEQERREQQQKLQAAQFMQQRVPVSQTPAINV
SVPTTLPSATQVPMEVLKVQTHLENPTKYHIQQAQRQQVKQYLSTTLANK
HANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGFYKFE
EQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQ
MANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTACIFPTE
SEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNK
GTILKASVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQAR
AHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDL
TDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLL
SSVSPGASKTSSRRSSMSMEETEHTC

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Wang Y., Radfar S., Liu S., Riker A.I., Khong H.T. (2010). Mitf-Mdel, a novel melanocyte/melanoma-specific isoform of microphthalmia-associated transcription factor-M, as a candidate biomarker for melanoma.. BMC Med. 8: 14 — 14.  PubMed DOI:10.1186/1741-7015-8-14
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lee Y.N., Nechushtan H., Figov N., Razin E. (2004). The function of lysyl-tRNA synthetase and Ap4A as signaling regulators of MITF activity in FcepsilonRI-activated mast cells.. Immunity 20: 145 — 151.  PubMed DOI:10.1016/S1074-7613(04)00020-2
  • Miller A.J., Levy C., Davis I.J., Razin E., Fisher D.E. (2005). Sumoylation of MITF and its related family members TFE3 and TFEB.. J. Biol. Chem. 280: 146 — 155.  PubMed DOI:10.1074/jbc.M411757200
  • Smith S.D., Kelley P.M., Kenyon J.B., Hoover D. (2000). Tietz syndrome (hypopigmentation/deafness) caused by mutation of MITF.. J. Med. Genet. 37: 446 — 448.  PubMed DOI:10.1136/jmg.37.6.446

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:7105 (англ.). Процитовано 30 серпня 2017. 
  2. UniProt, O75030 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]