MLXIPL

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MLXIPL
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MLXIPL, CHREBP, MIO, MONDOB, WBSCR14, WS-bHLH, bHLHd14, MLX interacting protein like, MLX
Зовнішні ІД OMIM: 605678 MGI: 1927999 HomoloGene: 32507 GeneCards: MLXIPL
Пов'язані генетичні захворювання
metabolic disease, lipid metabolism disorder[1]
Шаблон експресії
PBB GE MLXIPL 221163 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_032951
NM_032952
NM_032953
NM_032954
NM_032994
NM_021455
NM_001359237
RefSeq (білок)
NP_116569
NP_116570
NP_116571
NP_116572
NP_067430
NP_001346166
Локус (UCSC) Хр. 7: 73.59 – 73.62 Mb Хр. 5: 135.09 – 135.14 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MLXIPL (англ. MLX interacting protein like) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 852 амінокислот, а молекулярна маса — 93 073[5].

Послідовність амінокислот
1020304050
MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSG
HFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGK
LVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKSPVCGFVTPLQ
GPEADAHRKPEAVVLEGNYWKRRIEVVMREYHKWRIYYKKRLRKPSREDD
LLAPKQAEGRWPPPEQWCKQLFSSVVPVLLGDPEEEPGGRQLLDLNCFLS
DISDTLFTMTQSGPSPLQLPPEDAYVGNADMIQPDLTPLQPSLDDFMDIS
DFFTNSRLPQPPMPSNFPEPPSFSPVVDSLFSSGTLGPEVPPASSAMTHL
SGHSRLQARNSCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPPPLLHYPP
PAKVPGLEPCPPPPFPPMAPPTALLQEEPLFSPRFPFPTVPPAPGVSPLP
APAAFPPTPQSVPSPAPTPFPIELLPLGYSEPAFGPCFSMPRGKPPAPSP
RGQKASPPTLAPATASPPTTAGSNNPCLTQLLTAAKPEQALEPPLVSSTL
LRSPGSPQETVPEFPCTFLPPTPAPTPPRPPPGPATLAPSRPLLVPKAER
LSPPAPSGSERRLSGDLSSMPGPGTLSVRVSPPQPILSRGRPDSNKTENR
RITHISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYI
LMLQQERAGLQEEAQQLRDEIEELNAAINLCQQQLPATGVPITHQRFDQM
RDMFDDYVRTRTLHNWKFWVFSILIRPLFESFNGMVSTASVHTLRQTSLA
WLDQYCSLPALRPTVLNSLRQLGTSTSILTDPGRIPEQATRAVTEGTLGK
PL

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • de Luis O., Valero M.C., Perez Jurado L.A. (2000). WBSCR14, a putative transcription factor gene deleted in Williams-Beuren syndrome: complete characterisation of the human gene and the mouse ortholog.. Eur. J. Hum. Genet. 8: 215 — 222.  PubMed DOI:10.1038/sj.ejhg.5200435
  • Cairo S., Merla G., Urbinati F., Ballabio A., Reymond A. (2001). WBSCR14, a gene mapping to the Williams-Beuren syndrome deleted region, is a new member of the Mlx transcription factor network.. Hum. Mol. Genet. 10: 617 — 627.  PubMed DOI:10.1093/hmg/10.6.617
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hillman R.T., Green R.E., Brenner S.E. (2004). An unappreciated role for RNA surveillance.. Genome Biol. 5: R8.1 — R8.16.  PubMed DOI:10.1186/gb-2004-5-2-r8

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]