MNDA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MNDA
Protein MNDA PDB 2dbg.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи MNDA, PYHIN3, myeloid cell nuclear differentiation antigen
Зовнішні ІД OMIM: 159553 HomoloGene: 74438 GeneCards: MNDA
Шаблон експресії
PBB GE MNDA 204959 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002432
н/д
RefSeq (білок)
NP_002423
н/д
Локус (UCSC) Хр. 1: 158.83 – 158.85 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

MNDA (англ. Myeloid cell nuclear differentiation antigen) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [2] Довжина поліпептидного ланцюга білка становить 407 амінокислот, а молекулярна маса — 45 836[3].

Послідовність амінокислот
1020304050
MVNEYKKILLLKGFELMDDYHFTSIKSLLAYDLGLTTKMQEEYNRIKITD
LMEKKFQGVACLDKLIELAKDMPSLKNLVNNLRKEKSKVAKKIKTQEKAP
VKKINQEEVGLAAPAPTARNKLTSEARGRIPVAQKRKTPNKEKTEAKRNK
VSQEQSKPPGPSGASTSAAVDHPPLPQTSSSTPSNTSFTPNQETQAQRQV
DARRNVPQNDPVTVVVLKATAPFKYESPENGKSTMFHATVASKTQYFHVK
VFDINLKEKFVRKKVITISDYSECKGVMEIKEASSVSDFNQNFEVPNRII
EIANKTPKISQLYKQASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDV
VGSGKWHNIKCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNK
EGPMNVN

Кодований геном білок за функціями належить до репресорів, активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Briggs J.A., Burrus G.R., Stickney B.D., Briggs R.C. (1992). Cloning and expression of the human myeloid cell nuclear differentiation antigen: regulation by interferon alpha.. J. Cell. Biochem. 49: 82 — 92.  PubMed DOI:10.1002/jcb.240490114
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Burrus G.R., Briggs J.A., Briggs R.C. (1992). Characterization of the human myeloid cell nuclear differentiation antigen: relationship to interferon-inducible proteins.. J. Cell. Biochem. 48: 190 — 202.  PubMed DOI:10.1002/jcb.240480210
  • Xie J., Briggs J.A., Briggs R.C. (1998). Human hematopoietic cell specific nuclear protein MNDA interacts with the multifunctional transcription factor YY1 and stimulates YY1 DNA binding.. J. Cell. Biochem. 70: 489 — 506.  PubMed DOI:10.1002/(SICI)1097-4644(19980915)70:4<489::AID-JCB6>3.0.CO;2-F

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:7183 (англ.). Процитовано 25 серпня 2017. 
  3. UniProt, P41218 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]