MRPS12

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MRPS12
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MRPS12, MPR-S12, MT-RPS12, RPMS12, RPS12, RPSM12, mitochondrial ribosomal protein S12
Зовнішні ІД OMIM: 603021 MGI: 1346333 HomoloGene: 6848 GeneCards: MRPS12
Шаблон експресії
PBB GE MRPS12 204331 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_033363
NM_021107
NM_033362
NM_011885
NM_001360250
NM_001360252
NM_001360254
RefSeq (білок)
NP_066930
NP_203526
NP_203527
NP_036015
NP_001347179
NP_001347181
NP_001347183
Локус (UCSC) Хр. 19: 38.93 – 38.93 Mb Хр. 7: 28.74 – 28.74 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MRPS12 (англ. Mitochondrial ribosomal protein S12) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 138 амінокислот, а молекулярна маса — 15 173[4].

Послідовність амінокислот
1020304050
MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLG
PTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGH
TLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK

Кодований геном білок за функціями належить до рибонуклеопротеїнів, рибосомних білків. Локалізований у мітохондрії.

Література[ред. | ред. код]

  • Shah Z.H., O'Dell K.M., Miller S.C.M., An X., Jacobs H.T. (1997). Metazoan nuclear genes for mitoribosomal protein S12.. Gene 204: 55 — 62.  PubMed DOI:10.1016/S0378-1119(97)00521-0
  • Johnson D.F., Hamon M., Fischel-Ghodsian N. (1998). Characterization of the human mitochondrial ribosomal S12 gene.. Genomics 52: 363 — 368.  PubMed DOI:10.1006/geno.1998.5448
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Amunts A., Brown A., Toots J., Scheres S.H., Ramakrishnan V. (2015). Ribosome. The structure of the human mitochondrial ribosome.. Science 348: 95 — 98.  PubMed DOI:10.1126/science.aaa1193

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:10380 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O15235 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]