MSX2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MSX2
Protein MSX2 PDB 1ig7.png
Ідентифікатори
Символи MSX2, CRS2, FPP, HOX8, MSH, PFM, PFM1, Msh homeobox 2
Зовнішні ІД OMIM: 123101 MGI: 97169 HomoloGene: 1837 GeneCards: MSX2
Пов'язані генетичні захворювання
Parietal foramina with cleidocranial dysplasia[1]
Шаблон експресії
PBB GE MSX2 205555 s at fs.png

PBB GE MSX2 210319 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002449
NM_001363626
NM_013601
RefSeq (білок)
NP_002440
NP_001350555
NP_038629
Локус (UCSC) Хр. 5: 174.72 – 174.73 Mb Хр. 13: 53.47 – 53.47 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MSX2 (англ. Msh homeobox 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 267 амінокислот, а молекулярна маса — 28 897[5].

Послідовність амінокислот
1020304050
MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVE
ALMSDKKPPKEASPLPAESASAGATLRPLLLSGHGAREAHSPGPLVKPFE
TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFT
TSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL
QEAELEKLKMAAKPMLPSSFSLPFPISSPLQAASIYGASYPFHRPVLPIP
PVGLYATPVGYGMYHLS

Кодований геном білок за функціями належить до репресорів, білків розвитку. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, остеогенез, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hodgkinson J.E., Davidson C.L., Beresford J., Sharpe P.T. (1993). Expression of a human homeobox-containing gene is regulated by 1,25(OH)2D3 in bone cells.. Biochim. Biophys. Acta 1174: 11 — 16.  PubMed DOI:10.1016/0167-4781(93)90086-S
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Iimura T. (1994). Molecular cloning and expression of homeobox-containing genes during hard tissue development.. Kokubyo Gakkai Zasshi 61: 590 — 604.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]