MYB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYB
Protein MYB PDB 1guu.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYB, Cmyb, c-myb, c-myb_CDS, efg, MYB proto-oncogene, transcription factor
Зовнішні ІД OMIM: 189990 MGI: 97249 HomoloGene: 31311 GeneCards: MYB
Пов'язані генетичні захворювання
Ожиріння[1]
Шаблон експресії
PBB GE MYB 204798 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001198914
NM_010848
NM_033597
RefSeq (білок)
NP_001185843
NP_034978
Локус (UCSC) Хр. 6: 135.18 – 135.22 Mb Хр. 10: 21.12 – 21.16 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYB (англ. MYB proto-oncogene, transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 640 амінокислот, а молекулярна маса — 72 341[5].

Послідовність амінокислот
1020304050
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEK
LKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEED
QRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEE
EDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQ
ESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHIS
EAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGE
HHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFID
SFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF
RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQD
VIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNFFCSHHWEGDS
LNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASP
LQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Majello B., Kenyon L.C., Dalla-Favera R. (1986). Human c-myb protooncogene: nucleotide sequence of cDNA and organization of the genomic locus.. Proc. Natl. Acad. Sci. U.S.A. 83: 9636 — 9640.  PubMed DOI:10.1073/pnas.83.24.9636
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Nicolaides N.C., Gualdi R., Casadevall C., Manzella L., Calabretta B. (1991). Positive autoregulation of c-myb expression via Myb binding sites in the 5' flanking region of the human c-myb gene.. Mol. Cell. Biol. 11: 6166 — 6176.  PubMed DOI:10.1128/MCB.11.12.6166
  • Matre V., Nordgaard O., Alm-Kristiansen A.H., Ledsaak M., Gabrielsen O.S. (2009). HIPK1 interacts with c-Myb and modulates its activity through phosphorylation.. Biochem. Biophys. Res. Commun. 388: 150 — 154.  PubMed DOI:10.1016/j.bbrc.2009.07.139
  • Westin E.H., Gorse K.M., Clarke M.F. (1990). Alternative splicing of the human c-myb gene.. Oncogene 5: 1117 — 1124.  PubMed
  • Jacobs S.M., Gorse K.M., Westin E.H. (1994). Identification of a second promoter in the human c-myb proto-oncogene.. Oncogene 9: 227 — 235.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]