MYBL2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYBL2
Protein MYBL2 PDB 1a5j.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYBL2, B-MYB, BMYB, MYB proto-oncogene like 2
Зовнішні ІД OMIM: 601415 MGI: 101785 HomoloGene: 1847 GeneCards: MYBL2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002466
NM_001278610
NM_008652
RefSeq (білок)
NP_001265539
NP_002457
NP_032678
Локус (UCSC) Хр. 20: 43.67 – 43.72 Mb Хр. 2: 163.05 – 163.08 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYBL2 (англ. MYB proto-oncogene like 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 700 амінокислот, а молекулярна маса — 78 764[4].

Послідовність амінокислот
1020304050
MSRRTRCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFG
QQDWKFLASHFPNRTDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKK
YGTKQWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSCWTEEEDRIICEAH
KVLGNRWAEIAKMLPGRTDNAVKNHWNSTIKRKVDTGGFLSESKDCKPPV
YLLLELEDKDGLQSAQPTEGQGSLLTNWPSVPPTIKEEENSEEELAAATT
SKEQEPIGTDLDAVRTPEPLEEFPKREDQEGSPPETSLPYKWVVEAANLL
IPAVGSSLSEALDLIESDPDAWCDLSKFDLPEEPSAEDSINNSLVQLQAS
HQQQVLPPRQPSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGG
SGIGTPPSVLKRQRKRRVALSPVTENSTSLSFLDSCNSLTPKSTPVKTLP
FSPSQFLNFWNKQDTLELESPSLTSTPVCSQKVVVTTPLHRDKTPLHQKH
AAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPHLEEDLKEVLR
SEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMS
TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPR
SHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Saville M.K., Watson R.J. (1998). The cell-cycle regulated transcription factor B-Myb is phosphorylated by cyclin A/Cdk2 at sites that enhance its transactivation properties.. Oncogene 17: 2679 — 2689.  PubMed DOI:10.1038/sj.onc.1202503
  • Bartsch O., Horstmann S., Toprak K., Klempnauer K.H., Ferrari S. (1999). Identification of cyclin A/Cdk2 phosphorylation sites in B-Myb.. Eur. J. Biochem. 260: 384 — 391.  PubMed DOI:10.1046/j.1432-1327.1999.00191.x
  • Takemoto Y., Tashiro S., Handa H., Ishii S. (1994). Multiple nuclear localization signals of the B-myb gene product.. FEBS Lett. 350: 55 — 60.  PubMed DOI:10.1016/0014-5793(94)00733-0
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7548 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P10244 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]