MYH1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYH1
Protein MYH1 PDB 1m8q.png
Ідентифікатори
Символи MYH1, HEL71, MYHSA1, MYHa, MyHC-2X/D, MyHC-2x, myosin, heavy chain 1, skeletal muscle, adult, myosin heavy chain 1
Зовнішні ІД OMIM: 160730 MGI: 1339711 HomoloGene: 133718 GeneCards: MYH1
Шаблон експресії
PBB GE MYH1 205951 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005963
NM_030679
RefSeq (білок)
NP_005954
NP_109604
Локус (UCSC) Хр. 17: 10.49 – 10.52 Mb Хр. 11: 67.2 – 67.22 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYH1 (англ. Myosin heavy chain 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 939 амінокислот, а молекулярна маса — 223 145[4].

Послідовність амінокислот
1020304050
MSSDSEMAIFGEAAPFLRKSERERIEAQNKPFDAKTSVFVVDPKESFVKA
TVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPKYDKIEDMAMMTHLHEP
AVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVTAYRGKKRQE
APPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIA
VTGEKKKEEVTSGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKF
IRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPDL
IEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIEILGFTSDERV
SIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLQNLNSADLLK
ALCYPRVKVGNEYVTKGQTVQQVYNAVGALAKAVYDKMFLWMVTRINQQL
DTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLE
QEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTS
FKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLIHYAGTVDYNIAGWLDKN
KDPLNETVVGLYQKSAMKTLALLFVGATGAEAEAGGGKKGGKKKGSSFQT
VSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCN
GVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLL
GSIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDEKLAQLITRTQAMCRGFL
ARVEYQKMVERRESIFCIQYNVRAFMNVKHWPWMKLYFKIKPLLKSAETE
KEMANMKEEFEKTKEELAKTEAKRKELEEKMVTLMQEKNDLQLQVQAEAD
SLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDE
CSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEK
KALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKKIRM
DLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEMSGLQSKIED
EQALGMQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEI
SERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKH
ADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNMETVSKAKGNLE
KMCRALEDQLSEIKTKEEEQQRLINDLTAQRARLQTESGEYSRQLDEKDT
LVSQLSRGKQAFTQQIEELKRQLEEEIKAKSALAHALQSSRHDCDLLREQ
YEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQR
LQDAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQ
RNFDKILAEWKQKCEETHAELEASQKESRSLSTELFKIKNAYEESLDQLE
TLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKSELQAALEE
AEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQMKRNHIRIVES
MQSTLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNT
QAILKDTQLHLDDALRSQEDLKEQLAMVERRANLLQAEIEELRATLEQTE
RSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIIQ
EARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHR
LDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNVEAVKGLRKHERK
VKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNVNLSKF
RRIQHELEEAEERADIAESQVNKLRVKSREVHTKIISEE

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків, фосфопротеїнів. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • Weiss A., Schiaffino S., Leinwand L.A. (1999). Comparative sequence analysis of the complete human sarcomeric myosin heavy chain family: implications for functional diversity.. J. Mol. Biol. 290: 61 — 75.  PubMed DOI:10.1006/jmbi.1999.2865
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Saez L., Leinwand L.A. (1986). Characterization of diverse forms of myosin heavy chain expressed in adult human skeletal muscle.. Nucleic Acids Res. 14: 2951 — 2969.  PubMed DOI:10.1093/nar/14.7.2951

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7567 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P12882 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]