MYH13

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYH13
Ідентифікатори
Символи MYH13, MyHC-IIL, MyHC-eo, myosin, heavy chain 13, skeletal muscle, myosin heavy chain 13
Зовнішні ІД OMIM: 603487 MGI: 1339967 HomoloGene: 55780 GeneCards: MYH13
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003802
NM_001081250
RefSeq (білок)
NP_003793
н/д
Локус (UCSC) Хр. 17: 10.3 – 10.37 Mb Хр. 11: 67.32 – 67.37 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYH13 (англ. Myosin heavy chain 13) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 938 амінокислот, а молекулярна маса — 223 605[4].

Послідовність амінокислот
1020304050
MSSDAEMAIFGEAAPYLRKPEKERIEAQNRPFDSKKACFVADNKEMYVKG
MIQTRENDKVIVKTLDDRMLTLNNDQVFPMNPPKFDKIEDMAMMTHLHEP
AVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYKPEVVAAYRGKKRQE
APPHIFSISDNAYQFMLTDRDNQSILITGESGAGKTVNTKRVIQYFATIA
VTGDKKKETQPGKMQGTLEDQIIQANPLLEAFGNAKTVRNDNSSRFGKFI
RIHFGATGKLASADIETYLLEKSRVTFQLSSERSYHIFYQIMSNKKPELI
DLLLISTNPFDFPFVSQGEVTVASIDDSEELLATDNAIDILGFSSEEKVG
IYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAGYLMGLNSAEMLKG
LCCPRVKVGNEYVTKGQNVQQVTNSVGALAKAVYEKMFLWMVTRINQQLD
TKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQ
EEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSF
KNKLYDQHLGKSNNFQKPKPAKGKAEAHFSLVHYAGTVDYNIAGWLDKNK
DPLNETVVGLYQKSSLKLLSFLFSNYAGAETGDSGGSKKGGKKKGSSFQT
VSAVFRENLNKLMTNLRSTHPHFVRCLIPNETKTPGVMDHYLVMHQLRCN
GVLEGIRICRKGFPSRILYADFKQRYRILNASAIPEGQFIDSKNASEKLL
NSIDVDREQFRFGNTKVFFKAGLLGLLEEMRDEKLVTLMTSTQAVCRGYL
MRVEFKKMMERRDSIFCIQYNIRSFMNVKHWPWMNLFFKIKPLLKSAEAE
KEMATMKEDFERTKEELARSEARRKELEEKMVSLLQEKNDLQLQVQSETE
NLMDAEERCEGLIKSKILLEAKVKELTERLEEEEEMNSELVAKKRNLEDK
CSSLKRDIDDLELTLTKVEKEKHATENKVKNLSEEMTALEENISKLTKEK
KSLQEAHQQTLDDLQVEEDKVNGLIKINAKLEQQTDDLEGSLEQEKKLRA
DLERAKRKLEGDLKMSQESIMDLENDKQQIEEKLKKKEFELSQLQAKIDD
EQVHSLQFQKKIKELQARIEELEEEIEAEHTLRAKIEKQRSDLARELEEI
SERLEEASGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKQ
ADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDMASNIEALSKSKSNIE
RTCRTVEDQFSEIKAKDEQQTQLIHDLNMQKARLQTQNGELSHRVEEKES
LISQLTKSKQALTQQLEELKRQMEEETKAKNAMAHALQSSRHDCDLLREQ
YEEEQEAKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQR
LQEAEENTETANSKCASLEKTKQRLQGEVEDLMRDLERSHTACATLDKKQ
RNFDKVLAEWKQKLDESQAELEAAQKESRSLSTELFKMRNAYEEVVDQLE
TLRRENKNLQEEISDLTEQIAETGKNLQEAEKTKKLVEQEKSDLQVALEE
VEGSLEHEESKILRVQLELSQVKSELDRKVIEKDEEIEQLKRNSQRAAEA
LQSVLDAEIRSRNDALRLKKKMEGDLNEMEIQLGHSNRQMAETQKHLRTV
QGQLKDSQLHLDDALRSNEDLKEQLAIVERRNGLLLEELEEMKVALEQTE
RTRRLSEQELLDASDRVQLLHSQNTSLINTKKKLEADIAQCQAEVENSIQ
ESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHR
LDEAEQLALKGGKKQIQKLENRVRELENELDVEQKRGAEALKGAHKYERK
VKEMTYQAEEDHKNILRLQDLVDKLQAKVKSYKRQAEEAEEQANTQLSRC
RRVQHELEEAAERADIAESQVNKLRAKSRDVGSQKMEE

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • Weiss A., Schiaffino S., Leinwand L.A. (1999). Comparative sequence analysis of the complete human sarcomeric myosin heavy chain family: implications for functional diversity.. J. Mol. Biol. 290: 61 — 75.  PubMed DOI:10.1006/jmbi.1999.2865
  • Winters L.M., Briggs M.M., Schachat F. (1998). The human extraocular muscle myosin heavy chain gene (MYH13) maps to the cluster of fast and developmental myosin genes on chromosome 17.. Genomics 54: 188 — 189.  PubMed DOI:10.1006/geno.1998.5558
  • Bloemink M.J., Deacon J.C., Resnicow D.I., Leinwand L.A., Geeves M.A. (2013). The superfast human extraocular myosin is kinetically distinct from the fast skeletal IIa, IIb, and IId isoforms.. J. Biol. Chem. 288: 27469 — 27479.  PubMed DOI:10.1074/jbc.M113.488130
  • Schachat F., Briggs M.M. (2002). Phylogenetic implications of the superfast myosin in extraocular muscles.. J. Exp. Biol. 205: 2189 — 2201.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7571 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9UKX3 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]