MYH3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYH3
Ідентифікатори
Символи MYH3, HEMHC, MYHC-EMB, MYHSE1, SMHCE, DA2A, DA2B, DA8, myosin, heavy chain 3, skeletal muscle, embryonic, myosin heavy chain 3, CPSKF1A, DA2B3, CPSKF1B
Зовнішні ІД OMIM: 160720 MGI: 1339709 HomoloGene: 20553 GeneCards: MYH3
Шаблон експресії
PBB GE MYH3 205940 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002470
NM_001099635
RefSeq (білок)
NP_002461
NP_001093105
Локус (UCSC) Хр. 17: 10.63 – 10.66 Mb Хр. 11: 67.08 – 67.1 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYH3 (англ. Myosin heavy chain 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 940 амінокислот, а молекулярна маса — 223 905[4].

Послідовність амінокислот
1020304050
MSSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKG
KIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP
AVLYNLKDRYTSWMIYTYSGLFCVTVNPYKWLPVYNPEVVEGYRGKKRQE
APPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIA
ATGDLAKKKDSKMKGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIR
IHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPELIE
LLLITTNPYDYPFISQGEILVASIDDAEELLATDSAIDILGFTPEEKSGL
YKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKTAYLMGLNSSDLLKAL
CFPRVKVGNEYVTKGQTVDQVHHAVNALSKSVYEKLFLWMVTRINQQLDT
KLPRQHFIGVLDIAGFEIFEYNSLEQLCINFTNEKLQQFFNHHMFVLEQE
EYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFK
NKLYDQHLGKSNNFQKPKVVKGRAEAHFSLIHYAGTVDYSVSGWLEKNKD
PLNETVVGLYQKSSNRLLAHLYATFATADADSGKKKVAKKKGSSFQTVSA
LFRENLNKLMSNLRTTHPHFVRCIIPNETKTPGAMEHSLVLHQLRCNGVL
EGIRICRKGFPNRILYGDFKQRYRVLNASAIPEGQFIDSKKACEKLLASI
DIDHTQYKFGHTKVFFKAGLLGTLEEMRDDRLAKLITRTQAVCRGFLMRV
EFQKMVQRRESIFCIQYNIRSFMNVKHWPWMKLFFKIKPLLKSAETEKEM
ATMKEEFQKTKDELAKSEAKRKELEEKLVTLVQEKNDLQLQVQAESENLL
DAEERCDQLIKAKFQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSE
LKKDIDDLELTLAKVEKEKHATENKVKNLTEELSGLDETIAKLTREKKAL
QEAHQQALDDLQAEEDKVNSLNKTKSKLEQQVEDLESSLEQEKKLRVDLE
RNKRKLEGDLKLAQESILDLENDKQQLDERLKKKDFEYCQLQSKVEDEQT
LGLQFQKKIKELQARIEELEEEIEAERATRAKTEKQRSDYARELEELSER
LEEAGGVTSTQIELNKKREAEFLKLRRDLEEATLQHEAMVAALRKKHADS
VAELGEQIDNLQRVKQKLEKEKSEFKLEIDDLSSSMESVSKSKANLEKIC
RTLEDQLSEARGKNEEIQRSLSELTTQKSRLQTEAGELSRQLEEKESIVS
QLSRSKQAFTQQTEELKRQLEEENKAKNALAHALQSSRHDCDLLREQYEE
EQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQD
SEEQVEAVNAKCASLEKTKQRLQGEVEDLMVDVERANSLAAALDKKQRNF
DKVLAEWKTKCEESQAELEASLKESRSLSTELFKLKNAYEEALDQLETVK
RENKNLEQEIADLTEQIAENGKTIHELEKSRKQIELEKADIQLALEEAEA
ALEHEEAKILRIQLELTQVKSEIDRKIAEKDEEIEQLKRNYQRTVETMQS
ALDAEVRSRNEAIRLKKKMEGDLNEIEIQLSHANRQAAETLKHLRSVQGQ
LKDTQLHLDDALRGQEDLKEQLAIVERRANLLQAEVEELRATLEQTERAR
KLAEQELLDSNERVQLLHTQNTSLIHTKKKLETDLMQLQSEVEDASRDAR
NAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDE
AEQLALKGGKKQIQKLETRIRELEFELEGEQKKNTESVKGLRKYERRVKE
LTYQSEEDRKNVLRLQDLVDKLQVKVKSYKRQAEEADEQANAHLTKFRKA
QHELEEAEERADIAESQVNKLRAKTRDFTSSRMVVHESEE

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • Karsch-Mizrachi I., Travis M., Blau H., Leinwand L.A. (1989). Expression and DNA sequence analysis of a human embryonic skeletal muscle myosin heavy chain gene.. Nucleic Acids Res. 17: 6167 — 6179.  PubMed DOI:10.1093/nar/17.15.6167

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7573 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P11055 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]