MYH7

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYH7
PBB Protein MYH7 image.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYH7, CMD1S, CMH1, MPD1, MYHCB, SPMD, SPMM, myosin, heavy chain 7, cardiac muscle, beta, myosin heavy chain 7
Зовнішні ІД OMIM: 160760 MGI: 2155600 HomoloGene: 68044 GeneCards: MYH7
Пов'язані генетичні захворювання
dilated cardiomyopathy 1S[1]
Шаблон експресії
PBB GE MYH6 204737 s at fs.png

PBB GE MYH7 216265 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000257
NM_080728
NM_001361607
RefSeq (білок)
NP_000248
NP_542766
NP_001348536
Локус (UCSC) Хр. 14: 23.41 – 23.44 Mb Хр. 14: 54.97 – 54.99 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYH7 (англ. Myosin heavy chain 7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 935 амінокислот, а молекулярна маса — 223 097[5].

Послідовність амінокислот
1020304050
MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAK
IVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPA
VLYNLKDRYGSWMIYTYSGLFCVTVNPYKWLPVYTPEVVAAYRGKKRSEA
PPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAA
IGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRI
HFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMY
KLTGAIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLC
HPRVKVGNEYVTKGQNVQQVIYATGALAKAVYERMFNWMVTRINATLETK
QPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEE
YKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKA
KLFDNHLGKSANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDP
LNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSAL
HRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLE
GIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLSSLD
IDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLARME
YKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAEREKEMA
SMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD
AEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSEL
KRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQ
EAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLER
AKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQAL
GSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERL
EEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV
AELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCR
TLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQ
LTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEE
TEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEA
EEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFD
KILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR
ENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKMELQSALEEAEAS
LEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTS
LDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLL
KDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRK
LAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRN
AEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA
EQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKEL
TYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQ
HELDEAEERADIAESQVNKLRAKSRDIGTKGLNEE

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків, фосфопротеїнів. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yamauchi-Takihara K., Sole M.J., Liew J., Ing D., Liew C.-C. (1989). Characterization of human cardiac myosin heavy chain genes.. Proc. Natl. Acad. Sci. U.S.A. 86: 3504 — 3508.  PubMed DOI:10.1073/pnas.86.10.3504
  • Cuda G., Fananapazir L., Zhu W.S., Sellers J.R., Epstein N.D. (1993). Skeletal muscle expression and abnormal function of beta-myosin in hypertrophic cardiomyopathy.. J. Clin. Invest. 91: 2861 — 2865.  PubMed DOI:10.1172/JCI116530
  • Lichter P., Umeda P.K., Levin J.E., Vosberg H.P. (1986). Partial characterization of the human beta-myosin heavy-chain gene which is expressed in heart and skeletal muscle.. Eur. J. Biochem. 160: 419 — 426.  PubMed DOI:10.1111/j.1432-1033.1986.tb09989.x
  • Saez L., Leinwand L.A. (1986). Characterization of diverse forms of myosin heavy chain expressed in adult human skeletal muscle.. Nucleic Acids Res. 14: 2951 — 2969.  PubMed DOI:10.1093/nar/14.7.2951
  • Jandreski M.A., Liew C.-C. (1987). Construction of a human ventricular cDNA library and characterization of a beta myosin heavy chain cDNA clone.. Hum. Genet. 76: 47 — 53.  PubMed DOI:10.1007/BF00283049

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]