MYL2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYL2
Ідентифікатори
Символи MYL2, CMH10, MLC2, MLC-2s/v, myosin light chain 2
Зовнішні ІД OMIM: 160781 MGI: 97272 HomoloGene: 55462 GeneCards: MYL2
Пов'язані генетичні захворювання
Ішемічна хвороба серця, hypertrophic cardiomyopathy 10[1]
Шаблон експресії
PBB GE MYL2 209742 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000432
NM_010861
RefSeq (білок)
NP_000423
NP_034991
Локус (UCSC) Хр. 12: 110.91 – 110.92 Mb Хр. 5: 122.1 – 122.11 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYL2 (англ. Myosin light chain 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 166 амінокислот, а молекулярна маса — 18 789[5].

Послідовність амінокислот
1020304050
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLR
DTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETIL
NAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNL
DYKNLVHIITHGEEKD

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків, фосфопротеїнів. Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • Libera L.D., Hoffmann E., Floroff M., Jackowski G. (1989). Isolation and nucleotide sequence of the cDNA encoding human ventricular myosin light chain 2.. Nucleic Acids Res. 17: 2360 — 2360.  PubMed DOI:10.1093/nar/17.6.2360
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Chang A.N., Chen G., Gerard R.D., Kamm K.E., Stull J.T. (2010). Cardiac myosin is a substrate for zipper-interacting protein kinase (ZIPK).. J. Biol. Chem. 285: 5122 — 5126.  PubMed DOI:10.1074/jbc.C109.076489
  • Wadgaonkar R., Shafiq S., Rajmanickam C., Siddiqui M.A. (1993). Interaction of a conserved peptide domain in recombinant human ventricular myosin light chain-2 with myosin heavy chain.. Cell. Mol. Biol. Res. 39: 13 — 26.  PubMed
  • Wentz-Hunter K., Ueda J., Yue B.Y. (2002). Protein interactions with myocilin.. Invest. Ophthalmol. Vis. Sci. 43: 176 — 182.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]