MYLK

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYLK
Protein MYLK PDB 2cqv.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYLK, AAT7, KRP, MLCK, MLCK1, MLCK108, MLCK210, MSTP083, MYLK1, smMLCK, myosin light chain kinase, MMIHS
Зовнішні ІД OMIM: 600922 MGI: 894806 HomoloGene: 14202 GeneCards: MYLK
Шаблон експресії
PBB GE MYLK 202555 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_139300
RefSeq (білок)
NP_647461
Локус (UCSC) Хр. 3: 123.61 – 123.88 Mb Хр. 16: 34.75 – 35 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYLK (англ. Myosin light chain kinase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 914 амінокислот, а молекулярна маса — 210 715[4].

Послідовність амінокислот
1020304050
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATA
KFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEED
RGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVE
TRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVP
LQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSI
QGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP
QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAA
RVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAAN
RRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEVSGIPKPEVAWFLE
GTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTASNAQGQLSCSW
TLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLN
GQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV
HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNP
PPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNS
AGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFP
TVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRV
GECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSLR
PGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQ
VDFRSVLAKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSA
ETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPM
GNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAF
KQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEG
SLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVR
AGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAA
RQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL
SWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEY
KFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYR
TVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA
KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERI
IDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTR
IKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVI
CYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLL
KKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGN
AVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV
AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIR
ESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE
TMEEGEGEGEEEEE

Кодований геном білок за функціями належить до трансфераз, кіназ, cерин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну, іонами металів, іоном кальцію, іоном магнію. Локалізований у цитоплазмі, цитоскелеті, клітинних відростках.

Література[ред. | ред. код]

  • Garcia J.G.N., Lazar V.L., Gilbert-Mcclain L.I., Gallagher P.J., Verin A.D. (1997). Myosin light chain kinase in endothelium: molecular cloning and regulation.. Am. J. Respir. Cell Mol. Biol. 16: 489 — 494.  PubMed DOI:10.1165/ajrcmb.16.5.9160829
  • Lazar V.L., Garcia J.G.N. (1999). A single human myosin light chain kinase gene (MLCK; MYLK).. Genomics 57: 256 — 267.  PubMed DOI:10.1006/geno.1999.5774
  • Dulyaninova N.G., Patskovsky Y.V., Bresnick A.R. (2004). The N-terminus of the long MLCK induces a disruption in normal spindle morphology and metaphase arrest.. J. Cell Sci. 117: 1481 — 1493.  PubMed DOI:10.1242/jcs.00993
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Dudek S.M., Birukov K.G., Zhan X., Garcia J.G.N. (2002). Novel interaction of cortactin with endothelial cell myosin light chain kinase.. Biochem. Biophys. Res. Commun. 298: 511 — 519.  PubMed DOI:10.1016/S0006-291X(02)02492-0
  • Shen M.-R., Furla P., Chou C.-Y., Ellory J.C. (2002). Myosin light chain kinase modulates hypotonicity-induced Ca2+ entry and Cl- channel activity in human cervical cancer cells.. Pflugers Arch. 444: 276 — 285.  PubMed DOI:10.1007/s00424-002-0811-3

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7590 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q15746 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]