MYLK4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYLK4
2X4F.pdb.png
Ідентифікатори
Символи SgK085caMLCK likesugen kinase 85MYLK4myosin light chain kinase family member 4
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

MYLK4 (англ. Myosin light chain kinase family member 4) – білок, який кодується однойменним геном, розташованим у людей на 6-ї хромосомі.[1] Довжина поліпептидного ланцюга білка становить 388 амінокислот, а молекулярна маса — 44 508[2].

Послідовність амінокислот
1020304050
MLKVKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSG
HNEAKEVWSNADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQGAV
NSFYTVSKTEILGGGRFGQVHKCEETATGLKLAAKIIKTRGMKDKEEVKN
EISVMNQLDHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDESYNLT
ELDTILFMKQICEGIRHMHQMYILHLDLKPENILCVNRDAKQIKIIDFGL
ARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVIAYMLLSGL
SPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRI
SASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDFVTK

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Manning G., Whyte D.B., Martinez R., Hunter T., Sudarsanam S. (2002). The protein kinase complement of the human genome.. Science 298: 1912 — 1934.  PubMed DOI:10.1126/science.1075762

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:27972 (англ.). Процитовано 19 вересня 2017. 
  2. UniProt, Q86YV6 (англ.). Процитовано 19 вересня 2017. 

Див. також[ред. | ред. код]