MYLK4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYLK4
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYLK4, SgK085, myosin light chain kinase family member 4
Зовнішні ІД MGI: 3643758 HomoloGene: 66243 GeneCards: MYLK4
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001012418
NM_001347872
NM_001166030
NM_001368880
RefSeq (білок)
NP_001012418
NP_001334801
NP_001159502
Локус (UCSC) Хр. 6: 2.66 – 2.75 Mb Хр. 13: 32.7 – 32.78 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYLK4 (англ. Myosin light chain kinase family member 4) – білок, який кодується однойменним геном, розташованим у людей на 6-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 388 амінокислот, а молекулярна маса — 44 508[4].

Послідовність амінокислот
1020304050
MLKVKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSG
HNEAKEVWSNADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQGAV
NSFYTVSKTEILGGGRFGQVHKCEETATGLKLAAKIIKTRGMKDKEEVKN
EISVMNQLDHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDESYNLT
ELDTILFMKQICEGIRHMHQMYILHLDLKPENILCVNRDAKQIKIIDFGL
ARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVIAYMLLSGL
SPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRI
SASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDFVTK

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Manning G., Whyte D.B., Martinez R., Hunter T., Sudarsanam S. (2002). The protein kinase complement of the human genome.. Science 298: 1912 — 1934.  PubMed DOI:10.1126/science.1075762

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:27972 (англ.). Процитовано 19 вересня 2017. 
  4. UniProt, Q86YV6 (англ.). Процитовано 19 вересня 2017. 

Див. також[ред. | ред. код]