MYO1F

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYO1F
Ідентифікатори
Символи MYO1F, myosin IF
Зовнішні ІД OMIM: 601480 MGI: 107711 HomoloGene: 56276 GeneCards: MYO1F
Шаблон експресії
PBB GE MYO1F 213733 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012335
NM_001348355
NM_053214
RefSeq (білок)
NP_036467
NP_001335284
н/д
Локус (UCSC) Хр. 19: 8.52 – 8.58 Mb Хр. 17: 33.56 – 33.61 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYO1F (англ. Myosin IF) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 098 амінокислот, а молекулярна маса — 124 844[4].

Послідовність амінокислот
1020304050
MGSKERFHWQSHNVKQSGVDDMVLLPQITEDAIAANLRKRFMDDYIFTYI
GSVLISVNPFKQMPYFTDREIDLYQGAAQYENPPHIYALTDNMYRNMLID
CENQCVIISGESGAGKTVAAKYIMGYISKVSGGGEKVQHVKDIILQSNPL
LEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVMQ
NENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDR
SDFGETLSAMQVIGIPPSIQQLVLQLVAGILHLGNISFCEDGNYARVESV
DLLAFPAYLLGIDSGRLQEKLTSRKMDSRWGGRSESINVTLNVEQAAYTR
DALAKGLYARLFDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQ
FCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIQYFNNKVVCDLIEN
KLSPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTHEHFNSWSAGF
VIHHYAGKVSYDVSGFCERNRDVLFSDLIELMQTSEQAFLRMLFPEKLDG
DKKGRPSTAGSKIKKQANDLVATLMRCTPHYIRCIKPNETKRPRDWEENR
VKHQVEYLGLKENIRVRRAGFAYRRQFAKFLQRYAILTPETWPRWRGDER
QGVQHLLRAVNMEPDQYQMGSTKVFVKNPESLFLLEEVRERKFDGFARTI
QKAWRRHVAVRKYEEMREEASNILLNKKERRRNSINRNFVGDYLGLEERP
ELRQFLGKRERVDFADSVTKYDRRFKPIKRDLILTPKCVYVIGREKVKKG
PEKGQVCEVLKKKVDIQALRGVSLSTRQDDFFILQEDAADSFLESVFKTE
FVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGFGD
LAVLKVGGRTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPP
RGMDRNGVPPSARGGPLPLEIMSGGGTHRPPRGPPSTSLGASRRPRARPP
SEHNTEFLNVPDQGMAGMQRKRSVGQRPVPGVGRPKPQPRTHGPRCRALY
QYVGQDVDELSFNVNEVIEILMEDPSGWWKGRLHGQEGLFPGNYVEKI

Кодований геном білок за функціями належить до білкових моторів, міозинів, фосфопротеїнів. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. (2008). Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.. J. Proteome Res. 7: 5167 — 5176.  PubMed DOI:10.1021/pr800500r

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7600 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O00160 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]