MYO5A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYO5A
Protein MYO5A PDB 1oe9.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYO5A, GS1, MYH12, MYO5, MYR12, myosin VA
Зовнішні ІД OMIM: 160777 MGI: 105976 HomoloGene: 20100 GeneCards: MYO5A
Шаблон експресії
PBB GE MYO5A 204527 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000259
NM_001142495
NM_010864
RefSeq (білок)
NP_000250
NP_001135967
NP_034994
Локус (UCSC) Хр. 15: 52.31 – 52.53 Mb Хр. 9: 75.07 – 75.22 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYO5A (англ. Myosin VA) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 855 амінокислот, а молекулярна маса — 215 405[4].

Послідовність амінокислот
1020304050
MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEY
HLDPKTKELPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIY
TYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQM
ARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSASEANVEEKVLASN
PIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVV
FQAEEERNYHIFYQLCASAKLPEFKMLRLGNADNFNYTKQGGSPVIEGVD
DAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTI
PPKHEPLCIFCELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNAR
DALAKHIYAKLFNWIVDNVNQALHSAVKQHSFIGVLDIYGFETFEINSFE
QFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIE
SKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRLSNKAFII
QHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAIS
PTSATSSGRTPLTRTPAKPTKGRPGQMAKEHKKTVGHQFRNSLHLLMETL
NATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSR
WTYQEFFSRYRVLMKQKDVLSDRKQTCKNVLEKLILDKDKYQFGKTKIFF
RAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYV
RGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRG
FLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMM
AKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLVEKL
TNLEGIYNSETEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLE
QTRSEKKCIEEHADRYKQETEQLVSNLKEENTLLKQEKEALNHRIVQQAK
EMTETMEKKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDLKEEMT
LMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRTEEPSEKKVPL
DMSLFLKLQKRVTELEQEKQVMQDELDRKEEQVLRSKAKEEERPQIRGAE
LEYESLKRQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLME
QLTSVSEELDVRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQ
KMKDKGEIAQAYIGLKETNRSSALDYHELNEDGELWLVYEGLKQANRLLE
SQLQSQKRSHENEAEALRGEIQSLKEENNRQQQLLAQNLQLPPEARIEAS
LQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMEN
ISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGV
AVNLIPGLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDD
FETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQ
VLSDLAIQIYQQLVRVLENILQPMIVSGMLEHETIQGVSGVKPTGLRKRT
SSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAIT
LNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQA
AQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSF
IRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLG
FISRV

Кодований геном білок за функціями належить до білкових моторів, міозинів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, транспорт білків, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну.

Література[ред. | ред. код]

  • Engle L.J., Kennett R.H. (1994). Cloning, analysis, and chromosomal localization of myoxin (MYH12), the human homologue to the mouse dilute gene.. Genomics 19: 407 — 416.  PubMed DOI:10.1006/geno.1994.1088

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7602 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9Y4I1 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]