NEFL

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NEFL
Ідентифікатори
Символи NEFL, CMT1F, CMT2E, NF-L, NF68, NFL, PPP1R110, neurofilament, light polypeptide, neurofilament light, CMTDIG
Зовнішні ІД OMIM: 162280 MGI: 97313 HomoloGene: 4487 GeneCards: NEFL
Пов'язані генетичні захворювання
Charcot-Marie-Tooth disease type 1F, Charcot-Marie-Tooth disease type 2E, Charcot-Marie-Tooth disease dominant intermediate G[1]
Шаблон експресії
PBB GE NEFL 221801 x at fs.png

PBB GE NEFL 221805 at fs.png

PBB GE NEFL 221916 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006158
NM_010910
RefSeq (білок)
NP_006149
NP_035040
Локус (UCSC) Хр. 8: 24.95 – 24.96 Mb Хр. 14: 68.08 – 68.09 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NEFL (англ. Neurofilament light) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 543 амінокислот, а молекулярна маса — 61 517[5].

Послідовність амінокислот
1020304050
MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSS
LSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDR
FASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQEIRDLRLAA
EDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGAD
EAALARAELEKRIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVEMDVT
KPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRA
AKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDT
INKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRL
SFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEE
QIEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEEAAEEEEAAKE
ESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання.

Література[ред. | ред. код]

  • Perez-Olle R., Leung C.L., Liem R.K. (2002). Effects of Charcot-Marie-Tooth-linked mutations of the neurofilament light subunit on intermediate filament formation.. J. Cell Sci. 115: 4937 — 4946.  PubMed DOI:10.1242/jcs.00148
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Nomata Y., Watanabe T., Wada H. (1983). Highly acidic proteins from human brain: purification and properties of Glu-50 protein.. J. Biochem. 93: 825 — 831.  PubMed DOI:10.1093/jb/93.3.825
  • Zuechner S., Vorgerd M., Sindern E., Schroeder J.M. (2004). The novel neurofilament light (NEFL) mutation Glu397Lys is associated with a clinically and morphologically heterogeneous type of Charcot-Marie-Tooth neuropathy.. Neuromuscul. Disord. 14: 147 — 157.  PubMed DOI:10.1016/j.nmd.2003.10.003
  • Pospelov V.A., Pospelova T.V., Julien J.-P. (1994). AP-1 and Krox-24 transcription factors activate the neurofilament light gene promoter in P19 embryonal carcinoma cells.. Cell Growth Differ. 5: 187 — 196.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]