NLRP1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NLRP1
PDB 1pn5 EBI.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NLRP1, CARD7, CIDED, CLR17.1, DEFCAP, DEFCAP-L/S, NAC, NALP1, PP1044, SLEV1, VAMAS1, NLR family, pyrin domain containing 1, NLR family pyrin domain containing 1, MSPC, AIADK
Зовнішні ІД OMIM: 606636 MGI: 3582959 HomoloGene: 19080 GeneCards: NLRP1
Шаблон експресії
PBB GE NLRP1 210113 s at fs.png

PBB GE NLRP1 211824 x at fs.png

PBB GE NLRP1 211822 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_033007
NM_001033053
NM_014922
NM_033004
NM_033006
NM_001039680
NM_001040696
NM_001162414
RefSeq (білок)
NP_001028225
NP_055737
NP_127497
NP_127499
NP_127500
NP_001035786
NP_001155886
Локус (UCSC) Хр. 17: 5.5 – 5.62 Mb Хр. 11: 71.15 – 71.23 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NLRP1 (англ. NLR family pyrin domain containing 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 473 амінокислот, а молекулярна маса — 165 866[4].

Послідовність амінокислот
1020304050
MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSG
MEVASYLVAQYGEQRAWDLALHTWEQMGLRSLCAQAQEGAGHSPSFPYSP
SEPHLGSPSQPTSTAVLMPWIHELPAGCTQGSERRVLRQLPDTSGRRWRE
ISASLLYQALPSSPDHESPSQESPNAPTSTAVLGSWGSPPQPSLAPREQE
APGTQWPLDETSGIYYTEIREREREKSEKGRPPWAAVVGTPPQAHTSLQP
HHHPWEPSVRESLCSTWPWKNEDFNQKFTQLLLLQRPHPRSQDPLVKRSW
PDYVEENRGHLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEA
WGRGQLYGDRFQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILS
RPERLLFILDGVDEPGWVLQEPSSELCLHWSQPQPADALLGSLLGKTILP
EASFLITARTTALQNLIPSLEQARWVEVLGFSESSRKEYFYRYFTDERQA
IRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKRKEKLTLTSKTTTTL
CLHYLAQALQAQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAI
ISTFLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYVLEDEKGRGKHSNCI
IDLEKTLEAYGIHGLFGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNL
MQWVPSLQLLLQPHSLESLHCLYETRNKTFLTQVMAHFEEMGMCVETDME
LLVCTFCIKFSRHVKKLQLIEGRQHRSTWSPTMVVLFRWVPVTDAYWQIL
FSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLETLRLAGCGLT
AEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQ
LVSCGLTSDCCQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPA
CKLIRLGLDQTTLSDEMRQELRALEQEKPQLLIFSRRKPSVMTPTEGLDT
GEMSNSTSSLKRQRLGSERAASHVAQANLKLLDVSKIFPIAEIAEESSPE
VVPVELLCVPSPASQGDLHTKPLGTDDDFWGPTGPVATEVVDKEKNLYRV
HFPVAGSYRWPNTGLCFVMREAVTVEIEFCVWDQFLGEINPQHSWMVAGP
LLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARV
ELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHL
YLIPSDCSIRKAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGML
EILPKELELCYRSPGEDQLFSEFYVGHLGSGIRLQVKDKKDETLVWEALV
KPGDLMPATTLIPPARIAVPSPLDAPQLLHFVDQYREQLIARVTSVEVVL
DKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKE
THPHLIMELWEKGSKKGLLPLSS

Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, взаємодія хазяїн-вірус, запальна відповідь, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Bertin J., DiStefano P.S. (2000). The PYRIN domain: a novel motif found in apoptosis and inflammation proteins.. Cell Death Differ. 7: 1273 — 1274.  PubMed DOI:10.1038/sj.cdd.4400774
  • Martinon F., Hofmann K., Tschopp J. (2001). The pyrin domain: a possible member of the death domain-fold family implicated in apoptosis and inflammation.. Curr. Biol. 11: R118 — R120.  PubMed DOI:10.1016/S0960-9822(01)00056-2
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Martinon F., Burns K., Tschopp J. (2002). The inflammasome: a molecular platform triggering activation of inflammatory caspases and processing of proIL-beta.. Mol. Cell 10: 417 — 426.  PubMed DOI:10.1016/S1097-2765(02)00599-3
  • Liao K.C., Mogridge J. (2009). Expression of Nlrp1b inflammasome components in human fibroblasts confers susceptibility to anthrax lethal toxin.. Infect. Immun. 77: 4455 — 4462.  PubMed DOI:10.1128/IAI.00276-09
  • Postigo A., Cross J.R., Downward J., Way M. (2006). Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis.. Cell Death Differ. 13: 1651 — 1662.  PubMed DOI:10.1038/sj.cdd.4401853

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:14374 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9C000 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]