NPAS2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NPAS2
Ідентифікатори
Символи NPAS2, MOP4, PASD4, bHLHe9, neuronal PAS domain protein 2
Зовнішні ІД OMIM: 603347 MGI: 109232 HomoloGene: 1887 GeneCards: NPAS2
Шаблон експресії
PBB GE NPAS2 205459 s at fs.png

PBB GE NPAS2 39548 at fs.png

PBB GE NPAS2 205460 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002518
NM_008719
RefSeq (білок)
NP_002509
NP_032745
Локус (UCSC) Хр. 2: 100.82 – 101 Mb Хр. 1: 39.19 – 39.36 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NPAS2 (англ. Neuronal PAS domain protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 824 амінокислот, а молекулярна маса — 91 791[4].

Послідовність амінокислот
1020304050
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLE
KVIGFLQKHNEVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAV
TTDGSIIYVSDSITPLLGHLPSDVMDQNLLNFLPEQEHSEVYKILSSHML
VTDSPSPEYLKSDSDLEFYCHLLRGSLNPKEFPTYEYIKFVGNFRSYNNV
PSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKEMCIVDEPLEE
FTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSV
VSYADVRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGAS
GLNTSHSPSASSRSSHKSSHTAMSEPTSTPTKLMAEASTPALPRSATLPQ
ELPVPGLSQAATMPAPLPSPSSCDLTQQLLPQTVLQSTPAPMAQFSAQFS
MFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDSNVQMFLQQPA
VSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLL
RESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAALPPSLNLTTP
ASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTG
RQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLHPSFPASQPSPLQ
PAQARQQPPQHYLQVQAPTSLHSEQQDSLLLSTYSQQPGTLGYPQPPPAQ
PQPLRPPRRVSSLSESSGLQQPPR

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, пошкодження ДНК, біологічні ритми, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном заліза, ДНК, гемом. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Reick M., Garcia J.A., Dudley C., McKnight S.L. (2001). NPAS2: an analog of clock operative in the mammalian forebrain.. Science 293: 506 — 509.  PubMed DOI:10.1126/science.1060699
  • Rutter J., Reick M., Wu L.C., McKnight S.L. (2001). Regulation of clock and NPAS2 DNA binding by the redox state of NAD cofactors.. Science 293: 510 — 514.  PubMed DOI:10.1126/science.1060698
  • Hoffman A.E., Zheng T., Ba Y., Zhu Y. (2008). The circadian gene NPAS2, a putative tumor suppressor, is involved in DNA damage response.. Mol. Cancer Res. 6: 1461 — 1468.  PubMed DOI:10.1158/1541-7786.MCR-07-2094
  • Eckel-Mahan K., Sassone-Corsi P. (2013). Metabolism and the circadian clock converge.. Physiol. Rev. 93: 107 — 135.  PubMed DOI:10.1152/physrev.00016.2012

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7895 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q99743 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]