NR2C1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR2C1
Ідентифікатори
Символи NR2C1, TR2, Testicular receptor 2, nuclear receptor subfamily 2 group C member 1
Зовнішні ІД OMIM: 601529 MGI: 1352465 HomoloGene: 55731 GeneCards: NR2C1
Шаблон експресії
PBB GE NR2C1 210530 s at fs.png

PBB GE NR2C1 204791 at fs.png

PBB GE NR2C1 210531 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001032287
NM_001127362
NM_003297
NM_011629
RefSeq (білок)
NP_001027458
NP_001120834
NP_003288
NP_003288.2
NP_035759
Локус (UCSC) Хр. 12: 95.02 – 95.07 Mb Хр. 10: 94.15 – 94.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR2C1 (англ. Nuclear receptor subfamily 2 group C member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 603 амінокислот, а молекулярна маса — 67 315[4].

Послідовність амінокислот
1020304050
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHD
GSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDN
SPDQGPNKVFDLCVVCGDKASGRHYGAVTCEGCKGFFKRSIRKNLVYSCR
GSKDCIINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNC
AASTEKIYIRKDLRSPLTATPTFVTDSESTRSTGLLDSGMFMNIHPSGVK
TESAVLMTSDKAESCQGDLSTLANVVTSLANLGKTKDLSQNSNEMSMIES
LSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSV
HLITGDSSINYTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRL
LFLSMHWALSIPSFQALGQENSISLVKAYWNELFTLGLAQCWQVMNVATI
LATFVNCLHNSLQQDKMSTERRKLLMEHIFKLQEFCNSMVKLCIDGYEYA
YLKAIVLFSPDHPSLENMEQIEKFQEKAYVEFQDYITKTYPDDTYRLSRL
LLRLPALRLMNATITEELFFKGLIGNIRIDSVIPHILKMEPADYNSQIIG
HSI

Кодований геном білок за функціями належить до репресорів, рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Chang C., Kokontis J. (1988). Identification of a new member of the steroid receptor super-family by cloning and sequence analysis.. Biochem. Biophys. Res. Commun. 155: 971 — 977.  PubMed DOI:10.1016/S0006-291X(88)80591-6
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lin Y.L., Wang Y.H., Lee H.J. (2006). Transcriptional regulation of the human TR2 orphan receptor gene by nuclear factor 1-A.. Biochem. Biophys. Res. Commun. 350: 430 — 436.  PubMed DOI:10.1016/j.bbrc.2006.09.061

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7971 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P13056 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]