NR2E3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR2E3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR2E3, Nr2e3, A930035N01Rik, PNR, RNR, rd7, ESCS, RP37, nuclear receptor subfamily 2 group E member 3
Зовнішні ІД OMIM: 604485 MGI: 1346317 HomoloGene: 84397 GeneCards: NR2E3
Пов'язані генетичні захворювання
enhanced S-cone syndrome, retinitis pigmentosa 37[1]
Шаблон експресії
PBB GE NR2E3 208388 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001281446
NM_014249
NM_016346
NM_013708
RefSeq (білок)
NP_055064
NP_057430
NP_038736
Локус (UCSC) Хр. 15: 71.79 – 71.82 Mb Хр. 9: 59.94 – 59.96 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR2E3 (англ. Nuclear receptor subfamily 2 group E member 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 410 амінокислот, а молекулярна маса — 44 692[5].

Послідовність амінокислот
1020304050
METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC
GDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQC
QACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPP
APAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSN
DPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQV
ILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMET
RVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQ
VMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPM
EKLLCDMFKN

Кодований геном білок за функціями належить до репресорів, рецепторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Peng G.H., Ahmad O., Ahmad F., Liu J., Chen S. (2005). The photoreceptor-specific nuclear receptor Nr2e3 interacts with Crx and exerts opposing effects on the transcription of rod versus cone genes.. Hum. Mol. Genet. 14: 747 — 764.  PubMed DOI:10.1093/hmg/ddi070
  • Sharon D., Sandberg M.A., Caruso R.C., Berson E.L., Dryja T.P. (2003). Shared mutations in NR2E3 in enhanced S-cone syndrome, Goldmann-Favre syndrome, and many cases of clumped pigmentary retinal degeneration.. Arch. Ophthalmol. 121: 1316 — 1323.  PubMed DOI:10.1001/archopht.121.9.1316

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]