NR2F2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR2F2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR2F2, ARP1, CHTD4, COUPTFB, COUPTFII, NF-E3, NR2F1, SVP40, TFCOUP2, COUP-TFII, nuclear receptor subfamily 2 group F member 2, COUPTF2, ARP-1
Зовнішні ІД OMIM: 107773 MGI: 1352452 HomoloGene: 7628 GeneCards: NR2F2
Шаблон експресії
PBB GE NR2F2 209121 x at fs.png

PBB GE NR2F2 209120 at fs.png

PBB GE NR2F2 215073 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021005
NM_001145155
NM_001145156
NM_001145157
NM_009697
NM_183261
RefSeq (білок)
NP_001138627
NP_001138628
NP_001138629
NP_066285
NP_033827
NP_899084
Локус (UCSC) Хр. 15: 96.33 – 96.34 Mb Хр. 7: 70.35 – 70.37 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR2F2 (англ. Nuclear receptor subfamily 2 group F member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 414 амінокислот, а молекулярна маса — 45 571[4].

Послідовність амінокислот
1020304050
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPAS
TPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCK
SFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQ
RGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQC
MQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWS
ELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVR
SQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDML
LSGSSFNWPYMAIQ

Кодований геном білок за функціями належить до рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Ladias J.A.A., Karathanasis S.K. (1991). Regulation of the apolipoprotein AI gene by ARP-1, a novel member of the steroid receptor superfamily.. Science 251: 561 — 565.  PubMed DOI:10.1126/science.1899293
  • Kobayashi T., Kodani Y., Nozawa A., Endo Y., Sawasaki T. (2008). DNA-binding profiling of human hormone nuclear receptors via fluorescence correlation spectroscopy in a cell-free system.. FEBS Lett. 582: 2737 — 2744.  PubMed DOI:10.1016/j.febslet.2008.07.003
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Chu K., Zingg H.H. (1997). The nuclear orphan receptors COUP-TFII and Ear-2 act as silencers of the human oxytocin gene promoter.. J. Mol. Endocrinol. 19: 163 — 172.  PubMed DOI:10.1677/jme.0.0190163
  • Wang L.H., Ing N.H., Tsai S.Y., O'Malley B.W., Tsai M.J. (1991). The COUP-TFs compose a family of functionally related transcription factors.. Gene Expr. 1: 207 — 216.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7976 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P24468 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]