NR4A2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR4A2
Protein NR4A2 PDB 1cit.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR4A2, HZF-3, NOT, NURR1, RNR1, TINUR, nuclear receptor subfamily 4 group A member 2
Зовнішні ІД OMIM: 601828 MGI: 1352456 HomoloGene: 4509 GeneCards: NR4A2
Шаблон експресії
PBB GE NR4A2 216248 s at fs.png

PBB GE NR4A2 204621 s at fs.png

PBB GE NR4A2 204622 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006186
NM_173171
NM_173172
NM_173173
NM_001139509
NM_013613
RefSeq (білок)
NP_006177
NP_775265
NP_006177.1
NP_001132981
NP_038641
Локус (UCSC) Хр. 2: 156.32 – 156.34 Mb Хр. 2: 57.11 – 57.12 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR4A2 (англ. Nuclear receptor subfamily 4 group A member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 598 амінокислот, а молекулярна маса — 66 591[4].

Послідовність амінокислот
1020304050
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTE
ITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNY
QQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLH
NFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHV
PMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPS
PPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPK
SPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDT
QHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLR
LAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDI
SAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPN
YLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Mages H.W., Rilke O., Bravo R., Senger G., Kroczek R.A. (1994). NOT, a human immediate-early response gene closely related to the steroid/thyroid hormone receptor NAK1/TR3.. Mol. Endocrinol. 8: 1583 — 1591.  PubMed DOI:10.1210/mend.8.11.7877627
  • Torii T., Kawarai T., Nakamura S., Kawakami H. (1999). Organization of the human orphan nuclear receptor Nurr1 gene.. Gene 230: 225 — 232.  PubMed DOI:10.1016/S0378-1119(99)00064-5
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Messmer K., Remington M.P., Skidmore F., Fishman P.S. (2007). Induction of tyrosine hydroxylase expression by the transcription factor Pitx3.. Int. J. Dev. Neurosci. 25: 29 — 37.  PubMed DOI:10.1016/j.ijdevneu.2006.11.003
  • Garcia-Yague A.J., Rada P., Rojo A.I., Lastres-Becker I., Cuadrado A. (2013). Nuclear import and export signals control the subcellular localization of Nurr1 protein in response to oxidative stress.. J. Biol. Chem. 288: 5506 — 5517.  PubMed DOI:10.1074/jbc.M112.439190

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7981 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, P43354 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]