NR5A2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR5A2
Protein NR5A2 PDB 1yok.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR5A2, B1F, B1F2, CPF, FTF, FTZ-F1, FTZ-F1beta, LRH-1, LRH1, hB1F-2, nuclear receptor subfamily 5 group A member 2
Зовнішні ІД OMIM: 604453 MGI: 1346834 HomoloGene: 20827 GeneCards: NR5A2
Пов'язані генетичні захворювання
рак підшлункової залози[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001276464
NM_003822
NM_205860
NM_001159769
NM_030676
RefSeq (білок)
NP_001263393
NP_003813
NP_995582
NP_001153241
NP_109601
Локус (UCSC) Хр. 1: 200.03 – 200.18 Mb Хр. 1: 136.84 – 136.96 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR5A2 (англ. Nuclear receptor subfamily 5 group A member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 541 амінокислот, а молекулярна маса — 61 331[5].

Послідовність амінокислот
1020304050
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEAL
GLARSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGL
LTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVG
MKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVI
QAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMP
PHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMAD
QTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKE
GSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVC
LKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLL
LRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ліпідами, іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Nitta M., Ku S., Brown C., Okamoto A.Y., Shan B. (1999). CPF: an orphan nuclear receptor that regulates liver-specific expression of the human cholesterol 7alpha-hydroxylase gene.. Proc. Natl. Acad. Sci. U.S.A. 96: 6660 — 6665.  PubMed DOI:10.1073/pnas.96.12.6660
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Galarneau L., Drouin R., Belanger L. (1998). Assignment of the fetoprotein transcription factor gene (FTF) to human chromosome band 1q32.11 by in situ hybridization.. Cytogenet. Cell Genet. 82: 269 — 270.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]