OR4K14

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
OR4K14
Ідентифікатори
Символи OR4K14, OR14-18, OR14-22, olfactory receptor family 4 subfamily K member 14
Зовнішні ІД HomoloGene: 128265 GeneCards: OR4K14
Шаблон експресії
PBB GE OR4K14 gnf1h02814 at fs.png

PBB GE OR4K14 gnf1h02813 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001004712
н/д
RefSeq (білок)
NP_001004712
н/д
Локус (UCSC) Хр. 14: 20.01 – 20.02 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

OR4K14 (англ. Olfactory receptor family 4 subfamily K member 14) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 310 амінокислот, а молекулярна маса — 35 053[3].

Послідовність амінокислот
1020304050
MDPQNYSLVSEFVLHGLCTSRHLQNFFFIFFFGVYVAIMLGNLLILVTVI
SDPCLHSSPMYFLLGNLAFLDMWLASFATPKMIRDFLSDQKLISFGGCMA
QIFFLHFTGGAEMVLLVSMAYDRYVAICKPLHYMTLMSWQTCIRLVLASW
VVGFVHSISQVAFTVNLPYCGPNEVDSFFCDLPLVIKLACMDTYVLGIIM
ISDSGLLSLSCFLLLLISYTVILLAIRQRAAGSTSKALSTCSAHIMVVTL
FFGPCIFVYVRPFSRFSVDKLLSVFYTIFTPLLNPIIYTLRNEEMKAAMK
KLQNRRVTFQ

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family.. Proc. Natl. Acad. Sci. U.S.A. 101: 2584 — 2589.  PubMed DOI:10.1073/pnas.0307882100
  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205 — 7205. 

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:15352 (англ.). Процитовано 11 вересня 2017. 
  3. UniProt, Q8NGD5 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]