OR6A2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
OR6A2
Ідентифікатори
Символи OR6A2, I7, OR11-55, OR6A1, OR6A2P, olfactory receptor family 6 subfamily A member 2
Зовнішні ІД OMIM: 608495 MGI: 97432 HomoloGene: 2743 GeneCards: OR6A2
Шаблон експресії
PBB GE OR6A2 221465 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003696
NM_010983
RefSeq (білок)
NP_003687
н/д
Локус (UCSC) Хр. 11: 6.79 – 6.8 Mb Хр. 7: 107 – 107.01 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OR6A2 (англ. Olfactory receptor family 6 subfamily A member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 327 амінокислот, а молекулярна маса — 36 154[4].

Послідовність амінокислот
1020304050
MEWRNHSGRVSEFVLLGFPAPAPLQVLLFALLLLAYVLVLTENTLIIMAI
RNHSTLHKPMYFFLANMSFLEIWYVTVTIPKMLAGFVGSKQDHGQLISFE
GCMTQLYFFLGLGCTECVLLAVMAYDRYMAICYPLHYPVIVSGRLCVQMA
AGSWAGGFGISMVKVFLISGLSYCGPNIINHFFCDVSPLLNLSCTDMSTA
ELTDFILAIFILLGPLSVTGASYVAITGAVMHIPSAAGRYKAFSTCASHL
TVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQ
EVKRALCCTLHLYQHQDPDPKKASRNV

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family.. Proc. Natl. Acad. Sci. U.S.A. 101: 2584 — 2589.  PubMed DOI:10.1073/pnas.0307882100
  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205 — 7205. 

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:15301 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, O95222 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]