PC (ген)

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PC
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PC, pyruvate carboxylase, PCB
Зовнішні ІД MGI: 97520 HomoloGene: 5422 GeneCards: PC
Пов'язані генетичні захворювання
human immunodeficiency virus infectious disease[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000920
NM_001040716
NM_022172
NM_001162946
NM_008797
RefSeq (білок)
NP_000911
NP_001035806
NP_071504
н/д
Локус (UCSC) Хр. 11: 66.85 – 66.96 Mb Хр. 19: 4.51 – 4.62 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PC (англ. Pyruvate carboxylase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 178 амінокислот, а молекулярна маса — 129 634[5].

Послідовність амінокислот
1020304050
MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLEYKPIKKVMVANRGEIAI
RVFRACTELGIRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIP
DIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMG
DKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFKAAYGGG
GRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQIL
GDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAK
QVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIH
VAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSG
EGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEF
RVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKL
LHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPPPAGFRDILLREGP
EGFARAVRNHPGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSK
LFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVG
YTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVV
EAAISYTGDVADPSRTKYSLQYYMGLAEELVRAGTHILCIKDMAGLLKPT
ACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAADS
MSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDC
TATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQM
LGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQG
YIGVPHGGFPEPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHGE
EVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEV
ELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHF
HPKALKDVKGQIGAPMPGKVIDIKVVAGAKVAKGQPLCVLSAMKMETVVT
SPMEGTVRKVHVTKDMTLEGDDLILEIE

Кодований геном білок за функціями належить до лігаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як метаболізм ліпідів, глюконеогенез, біосинтез ліпідів, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, іонами металів, молекулою піровиноградної кислоти, іоном марганцю. Локалізований у мітохондрії.

Література[ред. | ред. код]

  • Mackay N., Rigat B., Douglas C., Chen H.S., Robinson B.H. (1994). cDNA cloning of human kidney pyruvate carboxylase.. Biochem. Biophys. Res. Commun. 202: 1009 — 1014.  PubMed DOI:10.1006/bbrc.1994.2029
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lamhonwah A.-M., Quan F., Gravel R.A. (1987). Sequence homology around the biotin-binding site of human propionyl-CoA carboxylase and pyruvate carboxylase.. Arch. Biochem. Biophys. 254: 631 — 636.  PubMed DOI:10.1016/0003-9861(87)90146-9
  • Xiang S., Tong L. (2008). Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.. Nat. Struct. Mol. Biol. 15: 295 — 302.  PubMed DOI:10.1038/nsmb.1393
  • Freytag S.O., Collier K.J. (1984). Molecular cloning of a cDNA for human pyruvate carboxylase. Structural relationship to other biotin-containing carboxylases and regulation of mRNA content in differentiating preadipocytes.. J. Biol. Chem. 259: 12831 — 12837.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]